• Gene id: 2205

Gene Summary

• Gene Symbol: FCER1A   Gene   UCSC   Ensembl
• Aliases: FCE1A, FcERI
• Gene name: Fc fragment of IgE receptor Ia
• Alternate names: high affinity immunoglobulin epsilon receptor subunit alpha, Fc IgE receptor, alpha polypeptide, Fc epsilon RI alpha-chain, Fc epsilon receptor Ia, Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide, Fc-epsilon RI-alpha, high affinity immunogl,
• Gene location: 1q23.2 (159283887: 159308223)     Exons: 7     NC_000001.11
• Gene summary(Entrez): The immunoglobulin epsilon receptor (IgE receptor) is the initiator of the allergic response. When two or more high-affinity IgE receptors are brought together by allergen-bound IgE molecules, mediators such as histamine that are responsible for allergy s
• OMIM: 147140

Protein Summary

• Protein general information: P12319  
  • Name: High affinity immunoglobulin epsilon receptor subunit alpha (Fc epsilon RI alpha) (FcERI) (IgE Fc receptor subunit alpha)
  • Length: 257  
  • Mass: 29596
• Sequence:

  MAPAMESPTLLCVALLFFAPDGVLAVPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETN
  SSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGE
  ALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQFFIPLLVVILFAVDTGLFIS
  TQQQVTFLLKIKRTRKGFRLLNPHPKPNPKNN

• Structural information:
  • Protein Domains: (30..11-)
    (/note="Ig-like-1)
    (111..19-)
    (/note="Ig-like-2")
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR003598  
  • Prosite: PS50835
  • PDB: 1ALS 1ALT 1F2Q 1F6A 1J86 1J87 1J88 1J89 1RPQ 2Y7Q
  • PDBsum: 1ALS 1ALT 1F2Q 1F6A 1J86 1J87 1J88 1J89 1RPQ 2Y7Q
  • DIP: 6166
  • STRING: ENSP00000357097
• Other Databases: GeneCards:  FCER1A  Malacards:  FCER1A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004888	transmembrane signaling receptor activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0007166	cell surface receptor signaling pathway	IBA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0019863	IgE binding	IEA	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0038095	Fc-epsilon receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0009986	cell surface	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04072	Phospholipase D signaling pathway
hsa04071	Sphingolipid signaling pathway
hsa04664	Fc epsilon RI signaling pathway
hsa05310	Asthma

Diseases

Associated diseases	References
Asthma	PMID:21388666
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R