• Gene id: 220441

Gene Summary

• Gene Symbol: RNF152   Gene   UCSC   Ensembl
• Gene name: ring finger protein 152
• Alternate names: E3 ubiquitin-protein ligase RNF152, RING-type E3 ubiquitin transferase RNF152,
• Gene location: 18q21.33 (61894419: 61808066)     Exons: 6     NC_000018.10
• OMIM: 606950

Protein Summary

• Protein general information: Q8N8N0  
  • Name: E3 ubiquitin protein ligase RNF152 (EC 2.3.2.27) (RING finger protein 152) (RING type E3 ubiquitin transferase RNF152)
  • Length: 203  
  • Mass: 22357
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  METLSQDSLLECQICFNYYSPRRRPKLLDCKHTCCSVCLQQMRTSQKDVRCPWCRGVTKLPPGFSVSQLPDDPEV
  LAVIAIPHTSEHTPVFIKLPSNGCYMLPLPISKERALLPGDMGCRLLPGSQQKSVTVVTIPAEQQPLQGGAPQEA
  VEEEQDRRGVVKSSTWSGVCTVILVACVLVFLLGIVLHNMSCISKRFTVISCG

• Structural information:
  • Interpro: IPR033609  IPR001841  IPR013083  
  • Prosite: PS50089
  • STRING: ENSP00000316628
• Other Databases: GeneCards:  RNF152  Malacards:  RNF152

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005765	lysosomal membrane	IBA	cellular component
GO:0034198	cellular response to amino acid starvation	IBA	biological process
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0070936	protein K48-linked ubiquitination	IBA	biological process
GO:0010508	positive regulation of autophagy	IBA	biological process
GO:0070936	protein K48-linked ubiquitination	IDA	biological process
GO:0005764	lysosome	IDA	cellular component
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0005765	lysosomal membrane	IDA	cellular component
GO:0034198	cellular response to amino acid starvation	IDA	biological process
GO:0061630	ubiquitin protein ligase activity	IMP	molecular function
GO:0070534	protein K63-linked ubiquitination	IMP	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0031301	integral component of organelle membrane	IMP	cellular component
GO:0010508	positive regulation of autophagy	IMP	biological process
GO:1904262	negative regulation of TORC1 signaling	IMP	biological process
GO:0031267	small GTPase binding	IPI	molecular function
GO:0005764	lysosome	IEA	cellular component
GO:0061630	ubiquitin protein ligase activity	IEA	molecular function
GO:0000209	protein polyubiquitination	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0010508	positive regulation of autophagy	IEA	biological process
GO:1904262	negative regulation of TORC1 signaling	IEA	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0061630	ubiquitin protein ligase activity	EXP	molecular function
GO:0016567	protein ubiquitination	TAS	biological process
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0034198	cellular response to amino acid starvation	IEA	biological process
GO:1904262	negative regulation of TORC1 signaling	IEA	biological process
GO:0010508	positive regulation of autophagy	IEA	biological process
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04150	mTOR signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881