• Gene id: 2204

Gene Summary

• Gene Symbol: FCAR   Gene   UCSC   Ensembl
• Aliases: CD89, CTB-61M7.2, FcalphaRI
• Gene name: Fc fragment of IgA receptor
• Alternate names: immunoglobulin alpha Fc receptor, FCAR variant 14, Fc alpha receptor, Fc fragment of IgA, receptor for,
• Gene location: 19q13.42 (54874230: 54891419)     Exons: 7     NC_000019.10
• Gene summary(Entrez): This gene is a member of the immunoglobulin gene superfamily and encodes a receptor for the Fc region of IgA. The receptor is a transmembrane glycoprotein present on the surface of myeloid lineage cells such as neutrophils, monocytes, macrophages, and eos
• OMIM: 602645

SNPs

rs1555633

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000013.11   g.31781295T>A
NC_000013.11   g.31781295T>G
NC_000013.10   g.32355432T>A
NC_000013.10   g.32355432T>G
NG_015819.1   g.46754T>A
NG_015819.1   g.46754T>G|SEQ=[T/A/G]|GENE=RXFP2

rs7325513

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000013.11   g.31786410A>C
NC_000013.11   g.31786410A>G
NC_000013.11   g.31786410A>T
NC_000013.10   g.32360547A>C
NC_000013.10   g.32360547A>G
NC_000013.10   g.32360547A>T
NG_015819.1   g.51869A>C
NG_015819.1   g.51869A>G
NG_015819.1   g.51869A>T
NM_130806.5   c.957A>

Protein Summary

• Protein general information: P24071  
  • Name: Immunoglobulin alpha Fc receptor (IgA Fc receptor) (CD antigen CD89)
  • Length: 287  
  • Mass: 32265
  • Tissue specificity: Isoform A.1, isoform A.2 and isoform A.3 are differentially expressed between blood and mucosal myeloid cells. Isoform A.1, isoform A.2 and isoform A.3 are expressed in monocytes. Isoform A.1 and isoform A.2 are expressed in alveolar m
• Sequence:

  MDPKQTTLLCLVLCLGQRIQAQEGDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQLMIIKNSTYREIGRRL
  KFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSADRGLVLMPGENISLTCSSAH
  IPFDRFSLAKEGELSLPQHQSGEHPANFSLGPVDLNVSGIYRCYGWYNRSPYLWSFPSNALELVVTDSIHQDYTT
  QNLIRMAVAGLVLVALLAILVENWHSHTALNKEASADVAEPSWSQQMCQPGLTFARTPSVCK

• Structural information:
  • Protein Domains: (42..10-)
    1 (/note="Ig-like-C2-type)
    (139..20-)
    2" (/note="Ig-like-C2-type)
  • Interpro: IPR036179  IPR013783  IPR003599  
  • PDB: 1OVZ 1OW0 1UCT
  • PDBsum: 1OVZ 1OW0 1UCT
  • STRING: ENSP00000347714
• Other Databases: GeneCards:  FCAR  Malacards:  FCAR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IEA	cellular component
GO:0019862	IgA binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006955	immune response	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0035579	specific granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0070821	tertiary granule membrane	TAS	cellular component
GO:0101003	ficolin-1-rich granule membrane	TAS	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04145	Phagosome
hsa05150	Staphylococcus aureus infection

Diseases

Associated diseases	References
Renal fibrosis	PMID:18250479
granulomatosis with polyangiitis	PMID:22147912
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881