• Gene id: 220134

Gene Summary

• Gene Symbol: SKA1   Gene   UCSC   Ensembl
• Aliases: C18orf24
• Gene name: spindle and kinetochore associated complex subunit 1
• Alternate names: spindle and kinetochore-associated protein 1, spindle and KT (kinetochore) associated 1,
• Gene location: 18q21.1 (50375045: 50394167)     Exons: 7     NC_000018.10
• OMIM: 112261

Protein Summary

• Protein general information: Q96BD8  
  • Name: Spindle and kinetochore associated protein 1
  • Length: 255  
  • Mass: 29484
• Sequence:

  MASSDLEQLCSHVNEKIGNIKKTLSLRNCGQEPTLKTVLNKIGDEIIVINELLNKLELEIQYQEQTNNSLKELCE
  SLEEDYKDIEHLKENVPSHLPQVTVTQSCVKGSDLDPEEPIKVEEPEPVKKPPKEQRSIKEMPFITCDEFNGVPS
  YMKSRLTYNQINDVIKEINKAVISKYKILHQPKKSMNSVTRNLYHRFIDEETKDTKGRYFIVEADIKEFTTLKAD
  KKFHVLLNILRHCRRLSEVRGGGLTRYVIT

• Structural information:
  • Interpro: IPR009829  IPR042031  
  • PDB: 4AJ5 4C9Y 4CA0
  • PDBsum: 4AJ5 4C9Y 4CA0
  • STRING: ENSP00000285116
• Other Databases: GeneCards:  SKA1  Malacards:  SKA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051301	cell division	IBA	biological process
GO:0031110	regulation of microtubule polymerization or depolymerization	IBA	biological process
GO:0008017	microtubule binding	IBA	molecular function
GO:0000940	condensed chromosome outer kinetochore	IBA	cellular component
GO:0000278	mitotic cell cycle	IBA	biological process
GO:0072686	mitotic spindle	IBA	cellular component
GO:0007059	chromosome segregation	IBA	biological process
GO:0005876	spindle microtubule	IBA	cellular component
GO:0031110	regulation of microtubule polymerization or depolymerization	IDA	biological process
GO:0008017	microtubule binding	IDA	molecular function
GO:0000940	condensed chromosome outer kinetochore	IDA	cellular component
GO:0000940	condensed chromosome outer kinetochore	IDA	cellular component
GO:0005876	spindle microtubule	IDA	cellular component
GO:0005876	spindle microtubule	IDA	cellular component
GO:0051301	cell division	IMP	biological process
GO:0000278	mitotic cell cycle	IMP	biological process
GO:0007059	chromosome segregation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008017	microtubule binding	IEA	molecular function
GO:0051301	cell division	IEA	biological process
GO:0007059	chromosome segregation	IEA	biological process
GO:0000776	kinetochore	IEA	cellular component
GO:0051301	cell division	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005819	spindle	IEA	cellular component
GO:0000777	condensed chromosome kinetochore	IEA	cellular component
GO:0015630	microtubule cytoskeleton	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881