• Gene id: 220064

Gene Summary

• Gene Symbol: LTO1   Gene   UCSC   Ensembl
• Aliases: CIAB1, ORAOV1, TAOS1
• Gene name: LTO1 maturation factor of ABCE1
• Alternate names: protein LTO1 homolog, LTO1, ABCE1 maturation factor, oral cancer overexpressed 1, oral cancer overexpressed protein 1-A, oral cancer-overexpressed protein 1, tumor-amplified and overexpressed sequence 1,
• Gene location: 11q13.3 (69675353: 69665562)     Exons: 5     NC_000011.10
• OMIM: 160998

Protein Summary

• Protein general information: Q8WV07  
  • Name: Protein LTO1 homolog (Oral cancer overexpressed protein 1) (Tumor amplified and overexpressed sequence 1)
  • Length: 137  
  • Mass: 15354
  • Tissue specificity: Widely expressed. Highly expressed in placenta, kidney and skeletal muscle. {ECO
• Sequence:

  MAGSQDIFDAIVMADERFHGEGYREGYEEGSSLGVMEGRQHGTLHGAKIGSEIGCYQGFAFAWKCLLHSCTTEKD
  SRKMKVLESLIGMIQKFPYDDPTYDKLHEDLDKIRGKFKQFCSLLNVQPDFKISAEGSGLSF

• Structural information:
  • Interpro: IPR019191  
  • STRING: ENSP00000279147
• Other Databases: GeneCards:  LTO1  Malacards:  LTO1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000723	telomere maintenance	IBA	biological process
GO:0106035	protein maturation by [4Fe-4S] cluster transfer	IDA	biological process
GO:0042273	ribosomal large subunit biogenesis	IMP	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0006413	translational initiation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005575	cellular_component	ND	cellular component
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881