• Gene id: 219988

Gene Summary

• Gene Symbol: PATL1   Gene   UCSC   Ensembl
• Aliases: Pat1b, hPat1b
• Gene name: PAT1 homolog 1, processing body mRNA decay factor
• Alternate names: protein PAT1 homolog 1, PAT1-like protein 1, protein PAT1 homolog b, protein associated with topoisomerase II homolog 1,
• Gene location: 11q12.1 (59669036: 59636715)     Exons: 19     NC_000011.10
• OMIM: 614660

Protein Summary

• Protein general information: Q86TB9  
  • Name: Protein PAT1 homolog 1 (PAT1 like protein 1) (Protein PAT1 homolog b) (Pat1b) (hPat1b)
  • Length: 770  
  • Mass: 86850
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MFRYESLEDCPLDEDEDAFQGLGEEDEEIDQFNDDTFGSGAVDDDWQEAHERLAELEEKLPVAVNEQTGNGERDE
  MDLLGDHEENLAERLSKMVIENELEDPAIMRAVQTRPVLQPQPGSLNSSIWDGSEVLRRIRGPLLAQEMPTVSVL
  EYALPQRPPQGPEDDRDLSERALPRRSTSPIIGSPPVRAVPIGTPPKQMAVPSFTQQILCPKPVHVRPPMPPRYP
  APYGERMSPNQLCSVPNSSLLGHPFPPSVPPVLSPLQRAQLLGGAQLQPGRMSPSQFARVPGFVGSPLAAMNPKL
  LQGRVGQMLPPAPGFRAFFSAPPSATPPPQQHPPGPGPHLQNLRSQAPMFRPDTTHLHPQHRRLLHQRQQQNRSQ
  HRNLNGAGDRGSHRSSHQDHLRKDPYANLMLQREKDWVSKIQMMQLQSTDPYLDDFYYQNYFEKLEKLSAAEEIQ
  GDGPKKERTKLITPQVAKLEHAYKPVQFEGSLGKLTVSSVNNPRKMIDAVVTSRSEDDETKEKQVRDKRRKTLVI
  IEKTYSLLLDVEDYERRYLLSLEEERPALMDDRKHKICSMYDNLRGKLPGQERPSDDHFVQIMCIRKGKRMVARI
  LPFLSTEQAADILMTTARNLPFLIKKDAQDEVLPCLLSPFSLLLYHLPSVSITSLLRQLMNLPQSAATPALSNPH
  LTAVLQNKFGLSLLLILLSRGEDLQSSDPATESTQNNQWTEVMFMATRELLRIPQAALAKPISIPTNLVSLFSRY
  VDRQKLNLLETKLQLVQGIR

• Structural information:
  • Interpro: IPR039900  IPR019167  
  • PDB: 2XEQ 2XER 2XES
  • PDBsum: 2XEQ 2XER 2XES
  • STRING: ENSP00000300146
• Other Databases: GeneCards:  PATL1  Malacards:  PATL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000290	deadenylation-dependent decapping of nuclear-transcribed mRNA	IBA	biological process
GO:0000932	P-body	IBA	cellular component
GO:0003723	RNA binding	IBA	molecular function
GO:0033962	cytoplasmic mRNA processing body assembly	IBA	biological process
GO:0030014	CCR4-NOT complex	IDA	colocalizes with
GO:0000932	P-body	IDA	cellular component
GO:0000932	P-body	IDA	cellular component
GO:0000932	P-body	IDA	cellular component
GO:0000932	P-body	IDA	cellular component
GO:0000290	deadenylation-dependent decapping of nuclear-transcribed mRNA	IDA	biological process
GO:0000290	deadenylation-dependent decapping of nuclear-transcribed mRNA	IDA	biological process
GO:0033962	cytoplasmic mRNA processing body assembly	IDA	biological process
GO:0003723	RNA binding	IDA	molecular function
GO:0003723	RNA binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000290	deadenylation-dependent decapping of nuclear-transcribed mRNA	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0034046	poly(G) binding	IDA	molecular function
GO:0000932	P-body	IDA	cellular component
GO:0008266	poly(U) RNA binding	IDA	molecular function
GO:0043928	exonucleolytic catabolism of deadenylated mRNA	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000932	P-body	IEA	cellular component
GO:0016607	nuclear speck	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016605	PML body	IEA	cellular component
GO:0036464	cytoplasmic ribonucleoprotein granule	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03018	RNA degradation

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)