• Gene id: 219855

Gene Summary

• Gene Symbol: SLC37A2   Gene   UCSC   Ensembl
• Aliases: pp11662
• Gene name: solute carrier family 37 member 2
• Alternate names: glucose-6-phosphate exchanger SLC37A2, solute carrier family 37 (glucose-6-phosphate transporter), member 2, solute carrier family 37 (glycerol-3-phosphate transporter), member 2, sugar phosphate exchanger 2,
• Gene location: 11q24.2 (125063066: 125090515)     Exons: 19     NC_000011.10
• OMIM: 612188

Protein Summary

• Protein general information: Q8TED4  
  • Name: Glucose 6 phosphate exchanger SLC37A2 (Solute carrier family 37 member 2)
  • Length: 501  
  • Mass: 54436
  • Tissue specificity: Detected in intestine and pancreas. Lower expression is also detected in liver and kidney. {ECO
• Sequence:

  MRSSLAPGVWFFRAFSRDSWFRGLILLLTFLIYACYHMSRKPISIVKSRLHQNCSEQIKPINDTHSLNDTMWCSW
  APFDKDNYKELLGGVDNAFLIAYAIGMFISGVFGERLPLRYYLSAGMLLSGLFTSLFGLGYFWNIHELWYFVVIQ
  VCNGLVQTTGWPSVVTCVGNWFGKGKRGFIMGIWNSHTSVGNILGSLIAGIWVNGQWGLSFIVPGIITAVMGVIT
  FLFLIEHPEDVDCAPPQHHGEPAENQDNPEDPGNSPCSIRESGLETVAKCSKGPCEEPAAISFFGALRIPGVVEF
  SLCLLFAKLVSYTFLYWLPLYIANVAHFSAKEAGDLSTLFDVGGIIGGIVAGLVSDYTNGRATTCCVMLILAAPM
  MFLYNYIGQDGIASSIVMLIICGGLVNGPYALITTAVSADLGTHKSLKGNAKALSTVTAIIDGTGSIGAALGPLL
  AGLISPTGWNNVFYMLISADVLACLLLCRLVYKEILAWKVSLSRGSGYKEI

• Structural information:
  • Interpro: IPR011701  IPR020846  IPR036259  IPR000849  
  • Prosite: PS50850
  • STRING: ENSP00000311833
• Other Databases: GeneCards:  SLC37A2  Malacards:  SLC37A2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015760	glucose-6-phosphate transport	IBA	biological process
GO:0030176	integral component of endoplasmic reticulum membrane	IBA	cellular component
GO:0061513	glucose 6-phosphate:inorganic phosphate antiporter activity	IBA	molecular function
GO:0035435	phosphate ion transmembrane transport	IBA	biological process
GO:0061513	glucose 6-phosphate:inorganic phosphate antiporter activity	IDA	molecular function
GO:0015760	glucose-6-phosphate transport	IDA	biological process
GO:0030176	integral component of endoplasmic reticulum membrane	IDA	cellular component
GO:0035435	phosphate ion transmembrane transport	IDA	biological process
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0015297	antiporter activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0008643	carbohydrate transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0015760	glucose-6-phosphate transport	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq