• Gene id: 219793

Gene Summary

• Gene Symbol: TBATA   Gene   UCSC   Ensembl
• Aliases: C10orf27, SPATIAL
• Gene name: thymus, brain and testes associated
• Alternate names: protein TBATA, stromal protein associated with thymii and lymph node homolog, thymus, brain and testes-associated protein,
• Gene location: 10q22.1 (70785400: 70771236)     Exons: 5     NC_000010.11
• Gene summary(Entrez): This gene encodes a protein that regulates thymic epithelial cell proliferation and thymus size. It has been identified as a ligand for the class I human leukocyte antigen (HLA-I) in thymus. Studies of the orthologous mouse protein suggest that it may als
• OMIM: 612640

Protein Summary

• Protein general information: Q96M53  
  • Name: Protein TBATA (Protein SPATIAL) (Stromal protein associated with thymii and lymph node homolog) (Thymus, brain and testes associated protein)
  • Length: 351  
  • Mass: 39460
• Sequence:

  MATDVQLADYPLMSPKAELKLEKKSGRKPRSPRDSGPQKELVIPGIVDFERIRRALRTPKPQTPGTYCFGRLSHH
  SFFSRHHPHPQHVTHIQDLTGKPVCVVRDFPAPLPESTVFSGCQMGIPTISVPIGDPQSNRNPQLSSEAWKKELK
  ELASRVAFLTKEDELKKKEKEQKEEPLREQGAKYSAETGRLIPASTRAVGRRRSHQGQQSQSSSRHEGVQAFLLQ
  DQELLVLELLCRILETDLLSAIQFWLLYAPPKEKDLALGLLQTAVAQLLPQPLVSIPTEKLLSQLPEVHEPPQEK
  QEPPCSQSPKKTKISPFTKSEKPEYIGEAQVLQMHSSQNTEKKTSKPRAES

• Structural information:
  • Interpro: IPR037394  
  • STRING: ENSP00000299290
• Other Databases: GeneCards:  TBATA  Malacards:  TBATA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007283	spermatogenesis	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0036064	ciliary basal body	IDA	cellular component
GO:0005829	cytosol	ISS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881