• Gene id: 219771

Gene Summary

• Gene Symbol: CCNY   Gene   UCSC   Ensembl
• Aliases: C10orf9, CBCP1, CCNX, CFP1
• Gene name: cyclin Y
• Alternate names: cyclin-Y, cyc-Y, cyclin box protein 1, cyclin fold protein 1, cyclin-X, cyclin-box carrying protein 1,
• Gene location: 10p11.21 (35247024: 35572669)     Exons: 14     NC_000010.11
• Gene summary(Entrez): Cyclins, such as CCNY, control cell division cycles and regulate cyclin-dependent kinases (e.g., CDC2; MIM 116940) (Li et al., 2009 [PubMed 18060517]).[supplied by OMIM, May 2009]
• OMIM: 612786

Protein Summary

• Protein general information: Q8ND76  
  • Name: Cyclin Y (Cyc Y) (Cyclin box protein 1) (Cyclin fold protein 1) (cyclin X)
  • Length: 341  
  • Mass: 39337
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MGNTTSCCVSSSPKLRRNAHSRLESYRPDTDLSREDTGCNLQHISDRENIDDLNMEFNPSDHPRASTIFLSKSQT
  DVREKRKSLFINHHPPGQIARKYSSCSTIFLDDSTVSQPNLKYTIKCVALAIYYHIKNRDPDGRMLLDIFDENLH
  PLSKSEVPPDYDKHNPEQKQIYRFVRTLFSAAQLTAECAIVTLVYLERLLTYAEIDICPANWKRIVLGAILLASK
  VWDDQAVWNVDYCQILKDITVEDMNELERQFLELLQFNINVPSSVYAKYYFDLRSLAEANNLSFPLEPLSRERAH
  KLEAISRLCEDKYKDLRRSARKRSASADNLTLPRWSPAIIS

• Structural information:
  • Protein Domains: (143..26-)
    (/note="Cyclin-N-terminal")
  • Interpro: IPR013763  IPR036915  IPR006671  IPR012399  
  • CDD: cd00043
  • STRING: ENSP00000363836
• Other Databases: GeneCards:  CCNY  Malacards:  CCNY

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0016538	cyclin-dependent protein serine/threonine kinase regulator activity	IBA	molecular function
GO:0045737	positive regulation of cyclin-dependent protein serine/threonine kinase activity	IBA	biological process
GO:0000086	G2/M transition of mitotic cell cycle	IDA	biological process
GO:0060828	regulation of canonical Wnt signaling pathway	IDA	biological process
GO:0045737	positive regulation of cyclin-dependent protein serine/threonine kinase activity	IDA	biological process
GO:0045737	positive regulation of cyclin-dependent protein serine/threonine kinase activity	IDA	biological process
GO:0016538	cyclin-dependent protein serine/threonine kinase regulator activity	IDA	molecular function
GO:0016538	cyclin-dependent protein serine/threonine kinase regulator activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0000308	cytoplasmic cyclin-dependent protein kinase holoenzyme complex	IDA	cellular component
GO:0000308	cytoplasmic cyclin-dependent protein kinase holoenzyme complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000079	regulation of cyclin-dependent protein serine/threonine kinase activity	IEA	biological process
GO:0019901	protein kinase binding	IEA	molecular function
GO:0051301	cell division	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray