• Gene id: 219738

Gene Summary

• Gene Symbol: FAM241B   Gene   UCSC   Ensembl
• Aliases: C10orf35
• Gene name: family with sequence similarity 241 member B
• Alternate names: protein FAM241B, uncharacterized protein C10orf35,
• Gene location: 10q22.1 (69630240: 69633598)     Exons: 6     NC_000010.11
• OMIM: 0

Protein Summary

• Protein general information: Q96D05  
  • Name: Protein FAM241B
  • Length: 121  
  • Mass: 13238
• Sequence:

  MVRILANGEIVQDDDPRVRTTTQPPRGSIPRQSFFNRGHGAPPGGPGPRQQQAGARLGAAQSPFNDLNRQLVNMG
  FPQWHLGNHAVEPVTSILLLFLLMMLGVRGLLLVGLVYLVSHLSQR

• Structural information:
  • Interpro: IPR027953  
  • STRING: ENSP00000362376
• Other Databases: GeneCards:  FAM241B  Malacards:  FAM241B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043231	intracellular membrane-bounded organelle	IBA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)