• Gene id: 219736

Gene Summary

• Gene Symbol: STOX1   Gene   UCSC   Ensembl
• Aliases: C10orf24
• Gene name: storkhead box 1
• Alternate names: storkhead-box protein 1, winged-helix domain-containing protein,
• Gene location: 10q22.1 (68827530: 68895941)     Exons: 6     NC_000010.11
• Gene summary(Entrez): The protein encoded by this gene may function as a DNA binding protein. Mutations in this gene are associated with pre-eclampsia/eclampsia 4 (PEE4). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [prov
• OMIM: 609397

Protein Summary

• Protein general information: Q6ZVD7  
  • Name: Storkhead box protein 1 (Winged helix domain containing protein)
  • Length: 989  
  • Mass: 110962
  • Tissue specificity: Expressed in placenta, including the invasive extravillus trophoblast cells. {ECO
• Sequence:

  MARPVQLAPGSLALVLCRLEAQKAAGAAEEPGGRAVFRAFRRANARCFWNARLARAASRLAFQGWLRRGVLLVRA
  PPACLQVLRDAWRRRALRPPRGFRIRAVGDVFPVQMNPITQSQFVPLGEVLCCAISDMNTAQIVVTQESLLERLM
  KHYPGIAIPSEDILYTTLGTLIKERKIYHTGEGYFIVTPQTYFITNTTTQENKRMLPSDESRLMPASMTYLVSME
  SCAESAQENAAPISHCQSCQCFRDMHTQDVQEAPVAAEVTRKSHRGLGESVSWVQNGAVSVSAEHHICESTKPLP
  YTRDKEKGKKFGFSLLWRSLSRKEKPKTEHSSFSAQFPPEEWPVRDEDDLDNIPRDVEHEIIKRINPILTVDNLI
  KHTVLMQKYEEQKKYNSQGTSTDMLTIGHKYPSKEGVKKRQGLSAKPQGQGHSRRDRHKARNQGSEFQPGSIRLE
  KHPKLPATQPIPRIKSPNEMVGQKPLGEITTVLGSHLIYKKRISNPFQGLSHRGSTISKGHKIQKTSDLKPSQTG
  PKEKPFQKPRSLDSSRIFDGKAKEPYAEQPNDKMEAESIYINDPTVKPINDDFRGHLFSHPQQSMLQNDGKCCPF
  MESMLRYEVYGGENEVIPEVLRKSHSHFDKLGETKQTPHSLPSRGASFSDRTPSACRLVDNTIHQFQNLGLLDYP
  VGVNPLRQAARQDKDSEELLRKGFVQDAETTSLENEQLSNDDQALYQNEVEDDDGACSSLYLEEDDISENDDLRQ
  MLPGHSQYSFTGGSQGNHLGKQKVIERSLTEYNSTMERVESQVLKRNECYKPTGLHATPGESQEPNLSAESCGLN
  SGAQFGFNYEEEPSVAKCVQASAPADERIFDYYSARKASFEAEVIQDTIGDTGKKPASWSQSPQNQEMRKHFPQK
  FQLFNTSHMPVLAQDVQYEHSHLEGTENHSMAGDSGIDSPRTQSLGSNNSVILDGLKRRQNFLQNVEGTKSSQPL
  TSNSLLPLTPVINV

• Structural information:
  • Interpro: IPR019391  IPR040126  
  • STRING: ENSP00000298596
• Other Databases: GeneCards:  STOX1  Malacards:  STOX1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0050679	positive regulation of epithelial cell proliferation	IEA	biological process
GO:0045787	positive regulation of cell cycle	IEA	biological process
GO:0005938	cell cortex	IEA	cellular component
GO:1904120	positive regulation of otic vesicle morphogenesis	IEA	biological process
GO:0051897	positive regulation of protein kinase B signaling	IEA	biological process
GO:0048839	inner ear development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0001650	fibrillar center	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0005813	centrosome	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0071500	cellular response to nitrosative stress	IMP	biological process
GO:0010821	regulation of mitochondrion organization	IMP	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IMP	biological process
GO:0010800	positive regulation of peptidyl-threonine phosphorylation	IMP	biological process
GO:1904031	positive regulation of cyclin-dependent protein kinase activity	IMP	biological process
GO:0010629	negative regulation of gene expression	IMP	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0061418	regulation of transcription from RNA polymerase II promoter in response to hypoxia	IMP	biological process
GO:0010971	positive regulation of G2/M transition of mitotic cell cycle	IMP	biological process
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:1902882	regulation of response to oxidative stress	IMP	biological process
GO:1904031	positive regulation of cyclin-dependent protein kinase activity	IMP	biological process
GO:1901858	regulation of mitochondrial DNA metabolic process	IMP	biological process
GO:0051881	regulation of mitochondrial membrane potential	IMP	biological process
GO:0010468	regulation of gene expression	IMP	biological process

Diseases

Associated diseases	References
Pre-eclampsia	PMID:23357179
Pre-eclampsia	PMID:15806103
Alzheimer's disease	PMID:20110611
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)