• Gene id: 2197

Gene Summary

• Gene Symbol: FAU   Gene   UCSC   Ensembl
• Aliases: FAU1, Fub1, Fubi, MNSFbeta, RPS30, S30, asr1
• Gene name: FAU ubiquitin like and ribosomal protein S30 fusion
• Alternate names: ubiquitin-like protein fubi and ribosomal protein S30, 40S ribosomal protein S30, FAU-encoded ubiquitin-like protein, FBR-MuSV-associated ubiquitously expressed, Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed (fox derived), monoclo,
• Gene location: 11q13.1 (65122133: 65120629)     Exons: 5     NC_000011.10
• Gene summary(Entrez): This gene is the cellular homolog of the fox sequence in the Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV). It encodes a fusion protein consisting of the ubiquitin-like protein fubi at the N terminus and ribosomal protein S30 at the C terminus. It
• OMIM: 134690

Protein Summary

• Protein general information: P35544  
  • Name: Ubiquitin like protein FUBI
  • Length: 74  
  • Mass: 7760
• Sequence:

  MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTLEVAGRMLGG

• Structural information:
  • Interpro: IPR000626  IPR029071  IPR019954  IPR019956  
  • Prosite: PS00299 PS50053
  • PDB: 2L7R
  • PDBsum: 2L7R
  • STRING: ENSP00000435370
• Other Databases: GeneCards:  FAU  Malacards:  FAU

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008150	biological_process	ND	biological process
GO:0005575	cellular_component	ND	cellular component
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03010	Ribosome

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)