• Gene id: 219699

Gene Summary

• Gene Symbol: UNC5B   Gene   UCSC   Ensembl
• Aliases: UNC5H2, p53RDL1
• Gene name: unc-5 netrin receptor B
• Alternate names: netrin receptor UNC5B, p53-regulated receptor for death and life protein 1, protein unc-5 homolog 2, protein unc-5 homolog B, transmembrane receptor Unc5H2, unc-5 homolog 2, unc-5 homolog B,
• Gene location: 10q22.1 (71212534: 71302878)     Exons: 20     NC_000010.11
• Gene summary(Entrez): This gene encodes a member of the netrin family of receptors. This particular protein mediates the repulsive effect of netrin-1 and is a vascular netrin receptor. This encoded protein is also in a group of proteins called dependence receptors (DpRs) which
• OMIM: 604269

Protein Summary

• Protein general information: Q8IZJ1  
  • Name: Netrin receptor UNC5B (Protein unc 5 homolog 2) (Protein unc 5 homolog B) (p53 regulated receptor for death and life protein 1) (p53RDL1)
  • Length: 945  
  • Mass: 103638
  • Tissue specificity: Highly expressed in brain. Also expressed at lower level in developing lung, cartilage, kidney and hematopoietic and immune tissues. {ECO
• Sequence:

  MGARSGARGALLLALLLCWDPRLSQAGTDSGSEVLPDSFPSAPAEPLPYFLQEPQDAYIVKNKPVELRCRAFPAT
  QIYFKCNGEWVSQNDHVTQEGLDEATGLRVREVQIEVSRQQVEELFGLEDYWCQCVAWSSAGTTKSRRAYVRIAY
  LRKNFDQEPLGKEVPLDHEVLLQCRPPEGVPVAEVEWLKNEDVIDPTQDTNFLLTIDHNLIIRQARLSDTANYTC
  VAKNIVAKRRSTTATVIVYVNGGWSSWAEWSPCSNRCGRGWQKRTRTCTNPAPLNGGAFCEGQAFQKTACTTICP
  VDGAWTEWSKWSACSTECAHWRSRECMAPPPQNGGRDCSGTLLDSKNCTDGLCMQNKKTLSDPNSHLLEASGDAA
  LYAGLVVAIFVVVAILMAVGVVVYRRNCRDFDTDITDSSAALTGGFHPVNFKTARPSNPQLLHPSVPPDLTASAG
  IYRGPVYALQDSTDKIPMTNSPLLDPLPSLKVKVYSSSTTGSGPGLADGADLLGVLPPGTYPSDFARDTHFLHLR
  SASLGSQQLLGLPRDPGSSVSGTFGCLGGRLSIPGTGVSLLVPNGAIPQGKFYEMYLLINKAESTLPLSEGTQTV
  LSPSVTCGPTGLLLCRPVILTMPHCAEVSARDWIFQLKTQAHQGHWEEVVTLDEETLNTPCYCQLEPRACHILLD
  QLGTYVFTGESYSRSAVKRLQLAVFAPALCTSLEYSLRVYCLEDTPVALKEVLELERTLGGYLVEEPKPLMFKDS
  YHNLRLSLHDLPHAHWRSKLLAKYQEIPFYHIWSGSQKALHCTFTLERHSLASTELTCKICVRQVEGEGQIFQLH
  TTLAETPAGSLDTLCSAPGSTVTTQLGPYAFKIPLSIRQKICNSLDAPNSRGNDWRMLAQKLSMDRYLNYFATKA
  SPTGVILDLWEALQQDDGDLNSLASALEEMGKSEMLVAVATDGDC

• Structural information:
  • Protein Domains: (48..14-)
    (/note="Ig-like-)
    (147..24-)
    (/note="Ig-like-C2-type)
    (246..30-)
    1 (/note="TSP-type-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00210-)
    (302..35-)
    2 (/note="TSP-type-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU0021-)
  • Interpro: IPR011029  IPR000488  IPR042156  IPR007110  IPR036179   IPR013783  IPR013098  IPR003599  IPR003598  IPR000884  IPR036383  IPR037936  IPR033772  IPR000906  
  • Prosite: PS50835 PS50092 PS51145
  • CDD: cd08802
  • DIP: 46275
  • STRING: ENSP00000334329
• Other Databases: GeneCards:  UNC5B  Malacards:  UNC5B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007411	axon guidance	IBA	biological process
GO:0033564	anterior/posterior axon guidance	IBA	biological process
GO:0005042	netrin receptor activity	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005042	netrin receptor activity	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0038007	netrin-activated signaling pathway	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0033564	anterior/posterior axon guidance	IEA	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:2001240	negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	IMP	biological process
GO:0043524	negative regulation of neuron apoptotic process	IMP	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04360	Axon guidance

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq