• Gene id: 219670

Gene Summary

• Gene Symbol: ENKUR   Gene   UCSC   Ensembl
• Aliases: C10orf63, CFAP106
• Gene name: enkurin, TRPC channel interacting protein
• Alternate names: enkurin,
• Gene location: 10p12.1 (25062278: 24981978)     Exons: 9     NC_000010.11
• Gene summary(Entrez): This gene encodes a protein that interacts with calmodulin and several transient receptor potential canonical cation channel proteins. The encoded protein may function as an adaptor to localize signal transduction machinery to calcium channels. Alternativ
• OMIM: 602003

Protein Summary

• Protein general information: Q8TC29  
  • Name: Enkurin
  • Length: 256  
  • Mass: 29454
• Sequence:

  MDPTCSSECIYNLIPSDLKEPPQPPRYISIFKATVKDDMQKAKTAMKTMGPAKVEVPSPKDFLKKHSKEKTLPPK
  KNFDRNVPKKPAVPLKTDHPVMGIQSGKNFINTNAADIIMGVAKKPKPIYVDKRTGDKHDLEPSGLVPKYINKKD
  YGVTPEYICKRNEEIKKAQEDYDRYIQENLKKAAMKRLSDEEREAVLQGLKKNWEEVHKEFQSLSVFIDSIPKKI
  RKQRLEEEMKQLEHDIGIIEKHKIIYIANNA

• Structural information:
  • Protein Domains: (160..25-)
    (/note="Enkurin-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01000-)
    (176..18-)
    (/note="IQ"-)
  • Interpro: IPR026150  IPR027012  
  • Prosite: PS51665
  • STRING: ENSP00000331044
• Other Databases: GeneCards:  ENKUR  Malacards:  ENKUR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005516	calmodulin binding	IBA	molecular function
GO:0001669	acrosomal vesicle	IBA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0017124	SH3 domain binding	IEA	molecular function
GO:0005516	calmodulin binding	IEA	molecular function
GO:0031514	motile cilium	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0097228	sperm principal piece	IEA	cellular component
GO:0005516	calmodulin binding	IEA	molecular function
GO:0001669	acrosomal vesicle	IEA	cellular component
GO:0031514	motile cilium	IEA	cellular component
GO:0061966	establishment of left/right asymmetry	IDA	biological process
GO:0097729	9+2 motile cilium	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881