• Gene id: 219623

Gene Summary

• Gene Symbol: TMEM26   Gene   UCSC   Ensembl
• Gene name: transmembrane protein 26
• Alternate names: transmembrane protein 26,
• Gene location: 10q21.2 (63529394: 63440769)     Exons: 16     NC_000001.11
• Gene summary(Entrez): This gene encodes a protein containing multiple transmembrane helices. It is a selective surface protein marker of brite/beige adipocytes, which may coexist with classical brown adipocytes in brown adipose tissue. Alternative splicing of this gene results
• OMIM: 617803

Protein Summary

• Protein general information: Q6ZUK4  
  • Name: Transmembrane protein 26
  • Length: 368  
  • Mass: 41672
• Sequence:

  MEGLVFLNALATRLLFLLHSLVGVWRVTEVKKEPRYWLLALLNLLLFLETALTLKFKRGRGYKWFSPAIFLYLIS
  IVPSLWLLELHHETQYCSIQAEGTSQNTSRKEDFNQTLTSNEQTSRADDLIETAKVFVNNLSTVCEKVWTLGLHQ
  TFLLMLIIGRWLLPIGGGITRDQLSQLLLMFVGTAADILEFTSETLEEQNVRNSPALVYAILVIWTWSMLQFPLD
  LAVQNVVCPVSVTERGFPSLFFCQYSADLWNIGISVFIQDGPFLVVRLILMTYFKVINQMLVFFAAKNFLVVVLQ
  LYRLVVLALAVRASLRSQSEGLKGEHGCRAQTSESGPSQRDWQNESKEGLAIPLRGSPVTSDDSHHTP

• Structural information:
  • Interpro: IPR019169  
  • STRING: ENSP00000382237
• Other Databases: GeneCards:  TMEM26  Malacards:  TMEM26

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)