• Gene id: 219539

Gene Summary

• Gene Symbol: YPEL4   Gene   UCSC   Ensembl
• Gene name: yippee like 4
• Alternate names: protein yippee-like 4,
• Gene location: 11q12.1 (74213570: 74262019)     Exons: 15     NC_000017.11
• OMIM: 609725

Protein Summary

• Protein general information: Q96NS1  
  • Name: Protein yippee like 4
  • Length: 127  
  • Mass: 14301
  • Tissue specificity: Widely expressed. Detected adult brain, lung, colon, small intestine and ovary, and in fetal brain, lung, liver and spleen. {ECO
• Sequence:

  MPSCDPGPGPACLPTKTFRSYLPRCHRTYSCVHCRAHLAKHDELISKSFQGSHGRAYLFNSVVNVGCGPAEQRLL
  LTGLHSVADIFCESCKTTLGWKYEQAFETSQKYKEGKYIIEMSHMVKDNGWD

• Structural information:
  • Protein Domains: (27..12-)
    (/note="Yippee-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01128"-)
  • Interpro: IPR034751  IPR004910  IPR039058  
  • Prosite: PS51792
  • STRING: ENSP00000432648
• Other Databases: GeneCards:  YPEL4  Malacards:  YPEL4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)