• Gene id: 219527

Gene Summary

• Gene Symbol: LRRC55   Gene   UCSC   Ensembl
• Gene name: leucine rich repeat containing 55
• Alternate names: leucine-rich repeat-containing protein 55, BK channel auxiliary gamma subunit LRRC55, BK channel auxilliary gamma snit LRRC55,
• Gene location: 11q12.1 (57181952: 57191716)     Exons: 2     NC_000011.10
• OMIM: 612022

Protein Summary

• Protein general information: Q6ZSA7  
  • Name: Leucine rich repeat containing protein 55 (BK channel auxiliary gamma subunit LRRC55)
  • Length: 298  
  • Mass: 33009
  • Tissue specificity: Mainly expressed in brain. {ECO
• Sequence:

  MGDTWAQLPWPGPPHPAMLLISLLLAAGLMHSDAGTSCPVLCTCRNQVVDCSSQRLFSVPPDLPMDTRNLSLAHN
  RITAVPPGYLTCYMELQVLDLHNNSLMELPRGLFLHAKRLAHLDLSYNNFSHVPADMFQEAHGLVHIDLSHNPWL
  RRVHPQAFQGLMQLRDLDLSYGGLAFLSLEALEGLPGLVTLQIGGNPWVCGCTMEPLLKWLRNRIQRCTADSQLA
  ECRGPPEVEGAPLFSLTEESFKACHLTLTLDDYLFIAFVGFVVSIASVATNFLLGITANCCHRWSKASEEEEI

• Structural information:
  • Protein Domains: (35..6-)
    (/note="LRRNT-)
    (196..25-)
    (/note="LRRCT"-)
  • Interpro: IPR000483  IPR001611  IPR003591  IPR032675  IPR000372  
  • Prosite: PS51450
  • STRING: ENSP00000419542
• Other Databases: GeneCards:  LRRC55  Malacards:  LRRC55

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005249	voltage-gated potassium channel activity	IBA	molecular function
GO:0008076	voltage-gated potassium channel complex	IBA	cellular component
GO:0099104	potassium channel activator activity	IBA	molecular function
GO:0044325	ion channel binding	IBA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005249	voltage-gated potassium channel activity	IDA	molecular function
GO:0008076	voltage-gated potassium channel complex	IDA	cellular component
GO:0099104	potassium channel activator activity	IDA	molecular function
GO:0071805	potassium ion transmembrane transport	IDA	biological process
GO:1903818	positive regulation of voltage-gated potassium channel activity	IDA	biological process
GO:0005887	integral component of plasma membrane	ISS	cellular component
GO:0044325	ion channel binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq