• Gene id: 2193

Gene Summary

• Gene Symbol: FARSA   Gene   UCSC   Ensembl
• Aliases: CML33, FARSL, FARSLA, FRSA, PheHA
• Gene name: phenylalanyl-tRNA synthetase subunit alpha
• Alternate names: phenylalanine--tRNA ligase alpha subunit, pheRS, phenylalanine tRNA ligase 1, alpha, cytoplasmic, phenylalanine--tRNA ligase alpha chain, phenylalanine-tRNA synthetase alpha-subunit, phenylalanine-tRNA synthetase-like, alpha subunit, phenylalanyl-tRNA synthetas,
• Gene location: 19p13.13 (12933710: 12922478)     Exons: 13     NC_000019.10
• Gene summary(Entrez): Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. This gene encodes a product which is similar to the catalytic subunit of prokaryotic and Saccharomyces cerevisiae phenylalanyl-tRNA synthetases (PheRS). Th
• OMIM: 605652

Protein Summary

• Protein general information: Q9Y285  
  • Name: Phenylalanine tRNA ligase alpha subunit (EC 6.1.1.20) (CML33) (Phenylalanyl tRNA synthetase alpha subunit) (PheRS)
  • Length: 508  
  • Mass: 57564
• Sequence:

  MADGQVAELLLRRLEASDGGLDSAELAAELGMEHQAVVGAVKSLQALGEVIEAELRSTKHWELTAEGEEIAREGS
  HEARVFRSIPPEGLAQSELMRLPSGKVGFSKAMSNKWIRVDKSAADGPRVFRVVDSMEDEVQRRLQLVRGGQAEK
  LGEKERSELRKRKLLAEVTLKTYWVSKGSAFSTSISKQETELSPEMISSGSWRDRPFKPYNFLAHGVLPDSGHLH
  PLLKVRSQFRQIFLEMGFTEMPTDNFIESSFWNFDALFQPQQHPARDQHDTFFLRDPAEALQLPMDYVQRVKRTH
  SQGGYGSQGYKYNWKLDEARKNLLRTHTTSASARALYRLAQKKPFTPVKYFSIDRVFRNETLDATHLAEFHQIEG
  VVADHGLTLGHLMGVLREFFTKLGITQLRFKPAYNPYTEPSMEVFSYHQGLKKWVEVGNSGVFRPEMLLPMGLPE
  NVSVIAWGLSLERPTMIKYGINNIRELVGHKVNLQMVYDSPLCRLDAEPRPPPTQEAA

• Structural information:
  • Interpro: IPR006195  IPR004529  IPR002319  IPR040724  IPR040586   IPR040725  IPR036390  
  • Prosite: PS50862
  • PDB: 3L4G
  • PDBsum: 3L4G
  • DIP: 53610
  • STRING: ENSP00000320309
• Other Databases: GeneCards:  FARSA  Malacards:  FARSA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0009328	phenylalanine-tRNA ligase complex	IBA	cellular component
GO:0006432	phenylalanyl-tRNA aminoacylation	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0004826	phenylalanine-tRNA ligase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0009328	phenylalanine-tRNA ligase complex	IDA	cellular component
GO:0004826	phenylalanine-tRNA ligase activity	IDA	molecular function
GO:0006432	phenylalanyl-tRNA aminoacylation	IDA	biological process
GO:0051290	protein heterotetramerization	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0000049	tRNA binding	IEA	molecular function
GO:0004812	aminoacyl-tRNA ligase activity	IEA	molecular function
GO:0004826	phenylalanine-tRNA ligase activity	IEA	molecular function
GO:0006432	phenylalanyl-tRNA aminoacylation	IEA	biological process
GO:0043039	tRNA aminoacylation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0004812	aminoacyl-tRNA ligase activity	IEA	molecular function
GO:0006412	translation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0016874	ligase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004826	phenylalanine-tRNA ligase activity	TAS	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0004826	phenylalanine-tRNA ligase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0006418	tRNA aminoacylation for protein translation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa00970	Aminoacyl-tRNA biosynthesis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881