• Gene id: 2185

Gene Summary

• Gene Symbol: PTK2B   Gene   UCSC   Ensembl
• Aliases: CADTK, CAKB, FADK2, FAK2, PKB, PTK, PYK2, RAFTK
• Gene name: protein tyrosine kinase 2 beta
• Alternate names: protein-tyrosine kinase 2-beta, CAK-beta, FADK 2, PTK2B protein tyrosine kinase 2 beta, calcium-dependent tyrosine kinase, calcium-regulated non-receptor proline-rich tyrosine kinase, cell adhesion kinase beta, focal adhesion kinase 2, proline-rich tyrosine kinas,
• Gene location: 8p21.2 (27311477: 27459390)     Exons: 39     NC_000008.11
• Gene summary(Entrez): This gene encodes a cytoplasmic protein tyrosine kinase which is involved in calcium-induced regulation of ion channels and activation of the map kinase signaling pathway. The encoded protein may represent an important signaling intermediate between neuro

Protein Summary

• Protein general information: Q14289  
  • Name: Protein tyrosine kinase 2 beta (EC 2.7.10.2) (Calcium dependent tyrosine kinase) (CADTK) (Calcium regulated non receptor proline rich tyrosine kinase) (Cell adhesion kinase beta) (CAK beta) (CAKB) (Focal adhesion kinase 2) (FADK 2) (Proline rich tyrosine
  • Length: 1009  
  • Mass: 115875
  • Tissue specificity: Most abundant in the brain, with highest levels in amygdala and hippocampus. Low levels in kidney (at protein level). Also expressed in spleen and lymphocytes. {ECO
• Sequence:

  MSGVSEPLSRVKLGTLRRPEGPAEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVKCTVQTEIREIITSIL
  LSGRIGPNIRLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYECLHVEAEWRYDLQIRYLPEDFMESLKEDRTT
  LLYFYQQLRNDYMQRYASKVSEGMALQLGCLELRRFFKDMPHNALDKKSNFELLEKEVGLDLFFPKQMQENLKPK
  QFRKMIQQTFQQYASLREEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLVIGPKGIRQLTSQDAKPTCLA
  EFKQIRSIRCLPLEEGQAVLQLGIEGAPQALSIKTSSLAEAENMADLIDGYCRLQGEHQGSLIIHPRKDGEKRNS
  LPQIPMLNLEARRSHLSESCSIESDIYAEIPDETLRRPGGPQYGIAREDVVLNRILGEGFFGEVYEGVYTNHKGE
  KINVAVKTCKKDCTLDNKEKFMSEAVIMKNLDHPHIVKLIGIIEEEPTWIIMELYPYGELGHYLERNKNSLKVLT
  LVLYSLQICKAMAYLESINCVHRDIAVRNILVASPECVKLGDFGLSRYIEDEDYYKASVTRLPIKWMSPESINFR
  RFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPDLCPPVLYTLMTRCWDYDPSDRPRFTEL
  VCSLSDVYQMEKDIAMEQERNARYRTPKILEPTAFQEPPPKPSRPKYRPPPQTNLLAPKLQFQVPEGLCASSPTL
  TSPMEYPSPVNSLHTPPLHRHNVFKRHSMREEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQE
  EKSLDPMVYMNDKSPLTPEKEVGYLEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMELVRAVLELKNELCQ
  LPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEECKRQ
  MLTASHTLAVDAKNLLDAVDQAKVLANLAHPPAE

• Structural information:
  • Protein Domains: (39..35-)
    (/note="FERM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00084-)
    (425..68-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR019749  IPR041390  IPR041784  IPR014352  IPR035963   IPR019748  IPR000299  IPR036137  IPR005189  IPR011009  IPR011993  IPR000719  IPR017441  IPR030610  IPR001245  IPR008266  IPR020635  IPR029071  
  • Prosite: PS50057 PS00107 PS50011 PS00109
  • CDD: cd14473 cd13190
  • PDB: 2FO6 2LK4 3CC6 3ET7 3FZO 3FZP 3FZR 3FZS 3FZT 3GM1 3GM2 3GM3 3H3C 3U3F 4EKU 4H1J 4H1M 4R32 4XEF 4XEK 4XEV 5TO8 5TOB 6LF3
  • PDBsum: 2FO6 2LK4 3CC6 3ET7 3FZO 3FZP 3FZR 3FZS 3FZT 3GM1 3GM2 3GM3 3H3C 3U3F 4EKU 4H1J 4H1M 4R32 4XEF 4XEK 4XEV 5TO8 5TOB 6LF3
  • STRING: ENSP00000380638
• Other Databases: GeneCards:  PTK2B  Malacards:  PTK2B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0048167	regulation of synaptic plasticity	TAS	biological process
GO:0014069	postsynaptic density	TAS	cellular component
GO:0038083	peptidyl-tyrosine autophosphorylation	IDA	biological process
GO:0030155	regulation of cell adhesion	IBA	biological process
GO:0001525	angiogenesis	IBA	biological process
GO:0043197	dendritic spine	IBA	cellular component
GO:0007173	epidermal growth factor receptor signaling pathway	IBA	biological process
GO:0005925	focal adhesion	IBA	cellular component
GO:2000058	regulation of ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0018108	peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IDA	molecular function
GO:0043267	negative regulation of potassium ion transport	IDA	biological process
GO:0030027	lamellipodium	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:2000114	regulation of establishment of cell polarity	ISS	biological process
GO:0070098	chemokine-mediated signaling pathway	ISS	biological process
GO:0046777	protein autophosphorylation	TAS	biological process
GO:0043552	positive regulation of phosphatidylinositol 3-kinase activity	ISS	biological process
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0042976	activation of Janus kinase activity	IMP	biological process
GO:0033209	tumor necrosis factor-mediated signaling pathway	IMP	biological process
GO:0030502	negative regulation of bone mineralization	ISS	biological process
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0030155	regulation of cell adhesion	IMP	biological process
GO:0008360	regulation of cell shape	IMP	biological process
GO:0008285	negative regulation of cell population proliferation	IMP	biological process
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0007229	integrin-mediated signaling pathway	IMP	biological process
GO:0002040	sprouting angiogenesis	ISS	biological process
GO:0001954	positive regulation of cell-matrix adhesion	IMP	biological process
GO:2000538	positive regulation of B cell chemotaxis	ISS	biological process
GO:2000249	regulation of actin cytoskeleton reorganization	ISS	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IMP	biological process
GO:0051279	regulation of release of sequestered calcium ion into cytosol	ISS	biological process
GO:0046330	positive regulation of JNK cascade	IMP	biological process
GO:0045860	positive regulation of protein kinase activity	IMP	biological process
GO:0045638	negative regulation of myeloid cell differentiation	IMP	biological process
GO:0045453	bone resorption	ISS	biological process
GO:0032960	regulation of inositol trisphosphate biosynthetic process	ISS	biological process
GO:0030838	positive regulation of actin filament polymerization	IMP	biological process
GO:0010758	regulation of macrophage chemotaxis	ISS	biological process
GO:0007166	cell surface receptor signaling pathway	IMP	biological process
GO:0002315	marginal zone B cell differentiation	ISS	biological process
GO:0002688	regulation of leukocyte chemotaxis	IEA	biological process
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0030155	regulation of cell adhesion	IEA	biological process
GO:0030334	regulation of cell migration	IEA	biological process
GO:0042127	regulation of cell population proliferation	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005925	focal adhesion	IEA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0007172	signal complex assembly	IEA	biological process
GO:0030500	regulation of bone mineralization	IEA	biological process
GO:0031234	extrinsic component of cytoplasmic side of plasma membrane	IEA	cellular component
GO:0045765	regulation of angiogenesis	IEA	biological process
GO:2000249	regulation of actin cytoskeleton reorganization	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0001525	angiogenesis	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0002250	adaptive immune response	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004715	non-membrane spanning protein tyrosine kinase activity	TAS	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0065003	protein-containing complex assembly	TAS	biological process
GO:0006468	protein phosphorylation	TAS	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0007172	signal complex assembly	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0008284	positive regulation of cell population proliferation	TAS	biological process
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0038110	interleukin-2-mediated signaling pathway	TAS	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000463	positive regulation of excitatory postsynaptic potential	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0098794	postsynapse	IEA	cellular component
GO:0097440	apical dendrite	IEA	cellular component
GO:0090630	activation of GTPase activity	IEA	biological process
GO:0060291	long-term synaptic potentiation	IEA	biological process
GO:0051968	positive regulation of synaptic transmission, glutamatergic	IEA	biological process
GO:0051592	response to calcium ion	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0048041	focal adhesion assembly	IEA	biological process
GO:0045727	positive regulation of translation	IEA	biological process
GO:0045471	response to ethanol	IEA	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0044297	cell body	IEA	cellular component
GO:0043423	3-phosphoinositide-dependent protein kinase binding	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0042976	activation of Janus kinase activity	IEA	biological process
GO:0038083	peptidyl-tyrosine autophosphorylation	IEA	biological process
GO:0032270	positive regulation of cellular protein metabolic process	IEA	biological process
GO:0031625	ubiquitin protein ligase binding	IEA	molecular function
GO:0031175	neuron projection development	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0030335	positive regulation of cell migration	IEA	biological process
GO:0030279	negative regulation of ossification	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0017146	NMDA selective glutamate receptor complex	IEA	cellular component
GO:0014009	glial cell proliferation	IEA	biological process
GO:0010243	response to organonitrogen compound	IEA	biological process
GO:0010226	response to lithium ion	IEA	biological process
GO:0009749	response to glucose	IEA	biological process
GO:0009612	response to mechanical stimulus	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0007015	actin filament organization	IEA	biological process
GO:0005938	cell cortex	IEA	cellular component
GO:0004972	NMDA glutamate receptor activity	IEA	molecular function
GO:0004683	calmodulin-dependent protein kinase activity	IEA	molecular function
GO:0001666	response to hypoxia	IEA	biological process
GO:0001556	oocyte maturation	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0000302	response to reactive oxygen species	IEA	biological process
GO:2000114	regulation of establishment of cell polarity	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0048010	vascular endothelial growth factor receptor signaling pathway	IEA	biological process
GO:0043552	positive regulation of phosphatidylinositol 3-kinase activity	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0030502	negative regulation of bone mineralization	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0010752	regulation of cGMP-mediated signaling	IEA	biological process
GO:0010595	positive regulation of endothelial cell migration	IEA	biological process
GO:0008360	regulation of cell shape	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IEA	molecular function
GO:0002040	sprouting angiogenesis	IEA	biological process
GO:2000573	positive regulation of DNA biosynthetic process	IEA	biological process
GO:2000379	positive regulation of reactive oxygen species metabolic process	IEA	biological process
GO:2000310	regulation of NMDA receptor activity	IEA	biological process
GO:0060292	long-term synaptic depression	IEA	biological process
GO:0051591	response to cAMP	IEA	biological process
GO:0051000	positive regulation of nitric-oxide synthase activity	IEA	biological process
GO:0045429	positive regulation of nitric oxide biosynthetic process	IEA	biological process
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0043534	blood vessel endothelial cell migration	IEA	biological process
GO:0043524	negative regulation of neuron apoptotic process	IEA	biological process
GO:0043507	positive regulation of JUN kinase activity	IEA	biological process
GO:0043197	dendritic spine	IEA	cellular component
GO:0043149	stress fiber assembly	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0042542	response to hydrogen peroxide	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0042220	response to cocaine	IEA	biological process
GO:0035902	response to immobilization stress	IEA	biological process
GO:0035235	ionotropic glutamate receptor signaling pathway	IEA	biological process
GO:0030426	growth cone	IEA	cellular component
GO:0030307	positive regulation of cell growth	IEA	biological process
GO:0019899	enzyme binding	IEA	molecular function
GO:0014069	postsynaptic density	IEA	cellular component
GO:0010656	negative regulation of muscle cell apoptotic process	IEA	biological process
GO:0009725	response to hormone	IEA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IEA	biological process
GO:0007173	epidermal growth factor receptor signaling pathway	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0006970	response to osmotic stress	IEA	biological process
GO:0006968	cellular defense response	IEA	biological process
GO:0005925	focal adhesion	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000165	MAPK cascade	IEA	biological process
GO:2000538	positive regulation of B cell chemotaxis	IEA	biological process
GO:2000249	regulation of actin cytoskeleton reorganization	IEA	biological process
GO:2000060	positive regulation of ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0071498	cellular response to fluid shear stress	IEA	biological process
GO:0051279	regulation of release of sequestered calcium ion into cytosol	IEA	biological process
GO:0051000	positive regulation of nitric-oxide synthase activity	IEA	biological process
GO:0050848	regulation of calcium-mediated signaling	IEA	biological process
GO:0045860	positive regulation of protein kinase activity	IEA	biological process
GO:0045766	positive regulation of angiogenesis	IEA	biological process
GO:0045453	bone resorption	IEA	biological process
GO:0045428	regulation of nitric oxide biosynthetic process	IEA	biological process
GO:0032960	regulation of inositol trisphosphate biosynthetic process	IEA	biological process
GO:0010758	regulation of macrophage chemotaxis	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0004672	protein kinase activity	IEA	molecular function
GO:0002315	marginal zone B cell differentiation	IEA	biological process
GO:0010595	positive regulation of endothelial cell migration	IDA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	IMP	biological process
GO:0010976	positive regulation of neuron projection development	IMP	biological process
GO:0071300	cellular response to retinoic acid	IMP	biological process
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IDA	molecular function
GO:0038083	peptidyl-tyrosine autophosphorylation	IDA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0005938	cell cortex	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005925	focal adhesion	IEA	cellular component
GO:0030027	lamellipodium	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0004683	calmodulin-dependent protein kinase activity	ISS	molecular function
GO:0004972	NMDA glutamate receptor activity	ISS	contributes to
GO:2000463	positive regulation of excitatory postsynaptic potential	ISS	biological process
GO:0017146	NMDA selective glutamate receptor complex	ISS	cellular component
GO:0030425	dendrite	ISS	cellular component
GO:0097440	apical dendrite	ISS	cellular component
GO:0044297	cell body	ISS	cellular component
GO:0038083	peptidyl-tyrosine autophosphorylation	ISS	biological process
GO:0060291	long-term synaptic potentiation	ISS	biological process
GO:0051968	positive regulation of synaptic transmission, glutamatergic	ISS	biological process
GO:0006968	cellular defense response	ISS	biological process
GO:2000310	regulation of NMDA receptor activity	ISS	biological process
GO:0035235	ionotropic glutamate receptor signaling pathway	ISS	biological process
GO:0043524	negative regulation of neuron apoptotic process	ISS	biological process
GO:0014069	postsynaptic density	ISS	cellular component
GO:0030426	growth cone	ISS	cellular component
GO:0043025	neuronal cell body	ISS	cellular component
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008022	protein C-terminus binding	IMP	molecular function
GO:0086100	endothelin receptor signaling pathway	IMP	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05163	Human cytomegalovirus infection
hsa04020	Calcium signaling pathway
hsa04062	Chemokine signaling pathway
hsa05170	Human immunodeficiency virus 1 infection
hsa04072	Phospholipase D signaling pathway
hsa05161	Hepatitis B
hsa05135	Yersinia infection
hsa04670	Leukocyte transendothelial migration
hsa04650	Natural killer cell mediated cytotoxicity
hsa04912	GnRH signaling pathway
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map

Diseases

Associated diseases	References
Prostate cancer	PMID:11204274
Hypertension	PMID:18075463
Breast cancer	PMID:16457699
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq