• Gene id: 2180

Gene Summary

• Gene Symbol: ACSL1   Gene   UCSC   Ensembl
• Aliases: ACS1, FACL1, FACL2, LACS, LACS1, LACS2
• Gene name: acyl-CoA synthetase long chain family member 1
• Alternate names: long-chain-fatty-acid--CoA ligase 1, LACS 1, LACS 2, acyl-CoA synthetase 1, arachidonate--CoA ligase, fatty-acid-Coenzyme A ligase, long-chain 1, fatty-acid-Coenzyme A ligase, long-chain 2, lignoceroyl-CoA synthase, long-chain acyl-CoA synthetase 1, long-chain acy,
• Gene location: 4q35.1 (172009603: 171861548)     Exons: 18     NC_000005.10
• Gene summary(Entrez): The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty
• OMIM: 152425

Protein Summary

• Protein general information: P33121  
  • Name: Long chain fatty acid CoA ligase 1 (EC 6.2.1.3) (Acyl CoA synthetase 1) (ACS1) (Arachidonate CoA ligase) (EC 6.2.1.15) (Long chain acyl CoA synthetase 1) (LACS 1) (Long chain acyl CoA synthetase 2) (LACS 2) (Long chain fatty acid CoA ligase 2) (Palmitoy
  • Length: 698  
  • Mass: 77943
  • Tissue specificity: Highly expressed in liver, heart, skeletal muscle, kidney and erythroid cells, and to a lesser extent in brain, lung, placenta and pancreas. {ECO
• Sequence:

  MQAHELFRYFRMPELVDFRQYVRTLPTNTLMGFGAFAALTTFWYATRPKPLKPPCDLSMQSVEVAGSGGARRSAL
  LDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSYKQVAELSECIGSALIQKGFKTAPDQFI
  GIFAQNRPEWVIIEQGCFAYSMVIVPLYDTLGNEAITYIVNKAELSLVFVDKPEKAKLLLEGVENKLIPGLKIIV
  VMDAYGSELVERGQRCGVEVTSMKAMEDLGRANRRKPKPPAPEDLAVICFTSGTTGNPKGAMVTHRNIVSDCSAF
  VKATENTVNPCPDDTLISFLPLAHMFERVVECVMLCHGAKIGFFQGDIRLLMDDLKVLQPTVFPVVPRLLNRMFD
  RIFGQANTTLKRWLLDFASKRKEAELRSGIIRNNSLWDRLIFHKVQSSLGGRVRLMVTGAAPVSATVLTFLRAAL
  GCQFYEGYGQTECTAGCCLTMPGDWTAGHVGAPMPCNLIKLVDVEEMNYMAAEGEGEVCVKGPNVFQGYLKDPAK
  TAEALDKDGWLHTGDIGKWLPNGTLKIIDRKKHIFKLAQGEYIAPEKIENIYMRSEPVAQVFVHGESLQAFLIAI
  VVPDVETLCSWAQKRGFEGSFEELCRNKDVKKAILEDMVRLGKDSGLKPFEQVKGITLHPELFSIDNGLLTPTMK
  AKRPELRNYFRSQIDDLYSTIKV

• Structural information:
  • Interpro: IPR025110  IPR020845  IPR000873  IPR042099  
  • Prosite: PS00455
  • STRING: ENSP00000422607
• Other Databases: GeneCards:  ACSL1  Malacards:  ACSL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004467	long-chain fatty acid-CoA ligase activity	IBA	molecular function
GO:0016020	membrane	IBA	cellular component
GO:0000038	very long-chain fatty acid metabolic process	IBA	biological process
GO:0001676	long-chain fatty acid metabolic process	IBA	biological process
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0008610	lipid biosynthetic process	IBA	biological process
GO:0035338	long-chain fatty-acyl-CoA biosynthetic process	IBA	biological process
GO:0047676	arachidonate-CoA ligase activity	IBA	molecular function
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0001676	long-chain fatty acid metabolic process	IDA	biological process
GO:0004467	long-chain fatty acid-CoA ligase activity	IDA	molecular function
GO:0047676	arachidonate-CoA ligase activity	ISS	molecular function
GO:0050197	phytanate-CoA ligase activity	ISS	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016874	ligase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0003996	acyl-CoA ligase activity	IEA	molecular function
GO:0102391	decanoate-CoA ligase activity	IEA	molecular function
GO:0047676	arachidonate-CoA ligase activity	IEA	molecular function
GO:0050197	phytanate-CoA ligase activity	IEA	molecular function
GO:0004467	long-chain fatty acid-CoA ligase activity	IEA	molecular function
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0036109	alpha-linolenic acid metabolic process	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0019216	regulation of lipid metabolic process	TAS	biological process
GO:0035338	long-chain fatty-acyl-CoA biosynthetic process	TAS	biological process
GO:0043651	linoleic acid metabolic process	TAS	biological process
GO:0120162	positive regulation of cold-induced thermogenesis	IEA	biological process
GO:0071902	positive regulation of protein serine/threonine kinase activity	IEA	biological process
GO:0033211	adiponectin-activated signaling pathway	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0042178	xenobiotic catabolic process	IEA	biological process
GO:0034201	response to oleic acid	IEA	biological process
GO:0019432	triglyceride biosynthetic process	IEA	biological process
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005778	peroxisomal membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0004467	long-chain fatty acid-CoA ligase activity	IEA	molecular function
GO:0050197	phytanate-CoA ligase activity	IEA	molecular function
GO:0047676	arachidonate-CoA ligase activity	IEA	molecular function
GO:0035338	long-chain fatty-acyl-CoA biosynthetic process	IEA	biological process
GO:0015908	fatty acid transport	IEA	biological process
GO:0014070	response to organic cyclic compound	IEA	biological process
GO:0010033	response to organic substance	IEA	biological process
GO:0007584	response to nutrient	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0001676	long-chain fatty acid metabolic process	IEA	biological process
GO:0000038	very long-chain fatty acid metabolic process	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0031090	organelle membrane	IEA	cellular component
GO:0005778	peroxisomal membrane	IEA	cellular component
GO:0120162	positive regulation of cold-induced thermogenesis	ISS	biological process
GO:0044539	long-chain fatty acid import into cell	IDA	biological process
GO:0008610	lipid biosynthetic process	IDA	biological process
GO:0001676	long-chain fatty acid metabolic process	IDA	biological process
GO:0005739	mitochondrion	IDA	cellular component
GO:0004467	long-chain fatty acid-CoA ligase activity	IDA	molecular function
GO:0004467	long-chain fatty acid-CoA ligase activity	IDA	molecular function
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04714	Thermogenesis
hsa04146	Peroxisome
hsa03320	PPAR signaling pathway
hsa01212	Fatty acid metabolism
hsa04920	Adipocytokine signaling pathway
hsa00071	Fatty acid degradation
hsa04216	Ferroptosis
hsa00061	Fatty acid biosynthesis

Diseases

Associated diseases	References
obesity	PMID:16788709
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881