• Gene id: 2173

Gene Summary

• Gene Symbol: FABP7   Gene   UCSC   Ensembl
• Aliases: B-FABP, BLBP, FABPB, MRG
• Gene name: fatty acid binding protein 7
• Alternate names: fatty acid-binding protein, brain, brain lipid-binding protein, brain-type fatty acid-binding protein, hypothetical protein DKFZp547J2313, mammary-derived growth inhibitor-related,
• Gene location: 6q22.31 (122749200: 122784076)     Exons: 5     NC_000006.12
• Gene summary(Entrez): The gene encodes a small, highly conserved cytoplasmic protein that bind long-chain fatty acids and other hydrophobic ligands. The encoded protein is important in the establishment of the radial glial fiber in the developing brain. Alternative splicing an
• OMIM: 165220

Protein Summary

• Protein general information: O15540  
  • Name: Fatty acid binding protein, brain (Brain lipid binding protein) (BLBP) (Brain type fatty acid binding protein) (B FABP) (Fatty acid binding protein 7) (Mammary derived growth inhibitor related)
  • Length: 132  
  • Mass: 14889
  • Tissue specificity: Expressed in brain and other neural tissues.
• Sequence:

  MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETT
  ADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA

• Structural information:
  • Interpro: IPR012674  IPR000463  IPR031259  IPR000566  
  • Prosite: PS00214
  • PDB: 1FDQ 1FE3 1JJX 5URA
  • PDBsum: 1FDQ 1FE3 1JJX 5URA
  • STRING: ENSP00000357429
• Other Databases: GeneCards:  FABP7  Malacards:  FABP7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008289	lipid binding	IEA	molecular function
GO:0008289	lipid binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0008289	lipid binding	TAS	molecular function
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0007399	nervous system development	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0019433	triglyceride catabolic process	TAS	biological process
GO:0071944	cell periphery	IEA	cellular component
GO:0044297	cell body	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0022008	neurogenesis	IEA	biological process
GO:0021846	cell proliferation in forebrain	IEA	biological process
GO:0005911	cell-cell junction	IEA	cellular component
GO:0001964	startle response	IEA	biological process
GO:0050673	epithelial cell proliferation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0060134	prepulse inhibition	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03320	PPAR signaling pathway

Diseases

Associated diseases	References
Glioblastoma multiforme	PMID:15827123
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881