• Gene id: 2172

Gene Summary

• Gene Symbol: FABP6   Gene   UCSC   Ensembl
• Aliases: I-15P, I-BABP, I-BALB, I-BAP, ILBP, ILBP3, ILLBP
• Gene name: fatty acid binding protein 6
• Alternate names: gastrotropin, GT, fatty acid binding protein 6, ileal, ileal bile acid binding protein, ileal lipid-binding protein, illeal lipid-binding protein, intestinal 15 kDa protein,
• Gene location: 5q33.3 (160187380: 160238721)     Exons: 7     NC_000005.10
• Gene summary(Entrez): This gene encodes the ileal fatty acid binding protein. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABP6 and FABP1 (the liver fatty acid binding
• OMIM: 600422

Protein Summary

• Protein general information: P51161  
  • Name: Gastrotropin (GT) (Fatty acid binding protein 6) (Ileal lipid binding protein) (ILBP) (Intestinal 15 kDa protein) (I 15P) (Intestinal bile acid binding protein) (I BABP)
  • Length: 128  
  • Mass: 14371
  • Tissue specificity: Isoform 1 is expressed in the jejunum, ileum, cecum and ascending colon intestine. Isoform 2 is xpressed in the gallbladder, duodenum, jejunum, ileum, cecum, ascending, transverse and descending colon, sigmoid colon and rectum. Isoform
• Sequence:

  MAFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESNIQTM
  GGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA

• Structural information:
  • Interpro: IPR012674  IPR000463  IPR031259  
  • Prosite: PS00214
  • PDB: 1O1U 1O1V 2MM3 5L8I 5L8N 5L8O
  • PDBsum: 1O1U 1O1V 2MM3 5L8I 5L8N 5L8O
  • STRING: ENSP00000377549
• Other Databases: GeneCards:  FABP6  Malacards:  FABP6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008289	lipid binding	IEA	molecular function
GO:0008289	lipid binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006869	lipid transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0008289	lipid binding	TAS	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0006629	lipid metabolic process	NAS	biological process
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0019433	triglyceride catabolic process	TAS	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03320	PPAR signaling pathway

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq