• Gene id: 2171

Gene Summary

• Gene Symbol: FABP5   Gene   UCSC   Ensembl
• Aliases: E-FABP, EFABP, KFABP, PA-FABP, PAFABP
• Gene name: fatty acid binding protein 5
• Alternate names: fatty acid-binding protein 5, epidermal-type fatty acid-binding protein, fatty acid binding protein 5 (psoriasis-associated), psoriasis-associated fatty acid-binding protein homolog,
• Gene location: 8q21.13 (6701832: 6634167)     Exons: 16     NC_000001.11
• Gene summary(Entrez): This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fa
• OMIM: 605168

Protein Summary

• Protein general information: Q01469  
  • Name: Fatty acid binding protein 5 (Epidermal type fatty acid binding protein) (E FABP) (Fatty acid binding protein, epidermal) (Psoriasis associated fatty acid binding protein homolog) (PA FABP)
  • Length: 135  
  • Mass: 15164
  • Tissue specificity: Keratinocytes; highly expressed in psoriatic skin (PubMed
• Sequence:

  MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEE
  TTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE

• Structural information:
  • Interpro: IPR012674  IPR000463  IPR031259  IPR000566  
  • Prosite: PS00214
  • PDB: 1B56 1JJJ 4AZM 4AZR 4LKP 4LKT 5HZ5 5UR9
  • PDBsum: 1B56 1JJJ 4AZM 4AZR 4LKP 4LKT 5HZ5 5UR9
  • STRING: ENSP00000297258
• Other Databases: GeneCards:  FABP5  Malacards:  FABP5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005324	long-chain fatty acid transporter activity	IMP	molecular function
GO:1990379	lipid transport across blood-brain barrier	IMP	biological process
GO:0015909	long-chain fatty acid transport	IMP	biological process
GO:0005504	fatty acid binding	IDA	molecular function
GO:0042802	identical protein binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0099178	regulation of retrograde trans-synaptic signaling by endocanabinoid	ISS	biological process
GO:0045202	synapse	ISS	cellular component
GO:0014069	postsynaptic density	ISS	cellular component
GO:0008289	lipid binding	IEA	molecular function
GO:0008289	lipid binding	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005504	fatty acid binding	TAS	molecular function
GO:0008289	lipid binding	TAS	molecular function
GO:0006629	lipid metabolic process	TAS	biological process
GO:0008544	epidermis development	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0030667	secretory granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0019433	triglyceride catabolic process	TAS	biological process
GO:0035578	azurophil granule lumen	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0006006	glucose metabolic process	IEA	biological process
GO:0006656	phosphatidylcholine biosynthetic process	IEA	biological process
GO:0042593	glucose homeostasis	IEA	biological process
GO:0099178	regulation of retrograde trans-synaptic signaling by endocanabinoid	IEA	biological process
GO:0001972	retinoic acid binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0010829	negative regulation of glucose transmembrane transport	IEA	biological process
GO:0014069	postsynaptic density	IEA	cellular component
GO:0031392	regulation of prostaglandin biosynthetic process	IEA	biological process
GO:0035360	positive regulation of peroxisome proliferator activated receptor signaling pathway	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0051930	regulation of sensory perception of pain	IEA	biological process
GO:0120162	positive regulation of cold-induced thermogenesis	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0120162	positive regulation of cold-induced thermogenesis	ISS	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03320	PPAR signaling pathway

Diseases

Associated diseases	References
Prostate cancer	PMID:16489065
Psoriasis	PMID:16283139
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray