• Gene id: 2170

Gene Summary

• Gene Symbol: FABP3   Gene   UCSC   Ensembl
• Aliases: FABP11, H-FABP, M-FABP, MDGI, O-FABP
• Gene name: fatty acid binding protein 3
• Alternate names: fatty acid-binding protein, heart, epididymis secretory sperm binding protein, fatty acid binding protein 11, fatty acid binding protein 3, muscle and heart, heart-type fatty acid-binding protein, mammary-derived growth inhibitor, muscle fatty acid-binding prot,
• Gene location: 1p35.2 (38704560: 38738264)     Exons: 17     NC_000022.11
• Gene summary(Entrez): The intracellular fatty acid-binding proteins (FABPs) belongs to a multigene family. FABPs are divided into at least three distinct types, namely the hepatic-, intestinal- and cardiac-type. They form 14-15 kDa proteins and are thought to participate in th
• OMIM: 134651

Protein Summary

• Protein general information: P05413  
  • Name: Fatty acid binding protein, heart (Fatty acid binding protein 3) (Heart type fatty acid binding protein) (H FABP) (Mammary derived growth inhibitor) (MDGI) (Muscle fatty acid binding protein) (M FABP)
  • Length: 133  
  • Mass: 14858
• Sequence:

  MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETT
  ADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA

• Structural information:
  • Interpro: IPR012674  IPR000463  IPR031259  IPR000566  
  • Prosite: PS00214
  • PDB: 1G5W 1HMR 1HMS 1HMT 2HMB 3RSW 3WBG 3WVM 3WXQ 4TJZ 4TKB 4TKH 4TKJ 4WBK 5B27 5B28 5B29 5CE4 5HZ9 6AQ1
  • PDBsum: 1G5W 1HMR 1HMS 1HMT 2HMB 3RSW 3WBG 3WVM 3WXQ 4TJZ 4TKB 4TKH 4TKJ 4WBK 5B27 5B28 5B29 5CE4 5HZ9 6AQ1
  • STRING: ENSP00000362817
• Other Databases: GeneCards:  FABP3  Malacards:  FABP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0140214	positive regulation of long-chain fatty acid import into cell	ISS	biological process
GO:0015909	long-chain fatty acid transport	ISS	biological process
GO:0008289	lipid binding	IEA	molecular function
GO:0008289	lipid binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0019433	triglyceride catabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0042632	cholesterol homeostasis	IEA	biological process
GO:0050873	brown fat cell differentiation	IEA	biological process
GO:0055091	phospholipid homeostasis	IEA	biological process
GO:2001245	regulation of phosphatidylcholine biosynthetic process	IEA	biological process
GO:0005504	fatty acid binding	IEA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0016528	sarcoplasm	IEA	cellular component
GO:0032868	response to insulin	IEA	biological process
GO:0015909	long-chain fatty acid transport	IEA	biological process
GO:0032365	intracellular lipid transport	IEA	biological process
GO:0046320	regulation of fatty acid oxidation	IEA	biological process
GO:0140214	positive regulation of long-chain fatty acid import into cell	IEA	biological process
GO:0005324	long-chain fatty acid transporter activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0015909	long-chain fatty acid transport	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0050543	icosatetraenoic acid binding	IEA	molecular function
GO:0070542	response to fatty acid	IEA	biological process
GO:0036041	long-chain fatty acid binding	IDA	molecular function
GO:0071073	positive regulation of phospholipid biosynthetic process	IC	biological process
GO:0070538	oleic acid binding	IDA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0042632	cholesterol homeostasis	ISS	biological process
GO:0055091	phospholipid homeostasis	ISS	biological process
GO:0032365	intracellular lipid transport	ISS	biological process
GO:0046320	regulation of fatty acid oxidation	ISS	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005615	extracellular space	HDA	cellular component
GO:0008092	cytoskeletal protein binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03320	PPAR signaling pathway

Diseases

Associated diseases	References
Alzheimer's disease	PMID:15068254
Hypertension	PMID:18437121
Down syndrome	PMID:15068254
Myocardial infarction	PMID:8326460
type 2 diabetes mellitus	PMID:12872269
obesity	PMID:17515913
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881