• Gene id: 2166

Gene Summary

• Gene Symbol: FAAH   Gene   UCSC   Ensembl
• Aliases: FAAH-1, PSAB
• Gene name: fatty acid amide hydrolase
• Alternate names: fatty-acid amide hydrolase 1, anandamide amidohydrolase 1, oleamide hydrolase 1,
• Gene location: 1p33 (46394316: 46413844)     Exons: 15     NC_000001.11
• Gene summary(Entrez): This gene encodes a protein that is responsible for the hydrolysis of a number of primary and secondary fatty acid amides, including the neuromodulatory compounds anandamide and oleamide. [provided by RefSeq, Jul 2008]

Protein Summary

• Protein general information: O00519  
  • Name: Fatty acid amide hydrolase 1 (EC 3.5.1.99) (Anandamide amidohydrolase 1) (Oleamide hydrolase 1)
  • Length: 579  
  • Mass: 63066
  • Tissue specificity: Highly expressed in the brain, small intestine, pancreas, skeletal muscle and testis. Also expressed in the kidney, liver, lung, placenta and prostate. {ECO
• Sequence:

  MVQYELWAALPGASGVALACCFVAAAVALRWSGRRTARGAVVRARQRQRAGLENMDRAAQRFRLQNPDLDSEALL
  ALPLPQLVQKLHSRELAPEAVLFTYVGKAWEVNKGTNCVTSYLADCETQLSQAPRQGLLYGVPVSLKECFTYKGQ
  DSTLGLSLNEGVPAECDSVVVHVLKLQGAVPFVHTNVPQSMFSYDCSNPLFGQTVNPWKSSKSPGGSSGGEGALI
  GSGGSPLGLGTDIGGSIRFPSSFCGICGLKPTGNRLSKSGLKGCVYGQEAVRLSVGPMARDVESLALCLRALLCE
  DMFRLDPTVPPLPFREEVYTSSQPLRVGYYETDNYTMPSPAMRRAVLETKQSLEAAGHTLVPFLPSNIPHALETL
  STGGLFSDGGHTFLQNFKGDFVDPCLGDLVSILKLPQWLKGLLAFLVKPLLPRLSAFLSNMKSRSAGKLWELQHE
  IEVYRKTVIAQWRALDLDVVLTPMLAPALDLNAPGRATGAVSYTMLYNCLDFPAGVVPVTTVTAEDEAQMEHYRG
  YFGDIWDKMLQKGMKKSVGLPVAVQCVALPWQEELCLRFMREVERLMTPEKQSS

• Structural information:
  • Interpro: IPR020556  IPR023631  IPR036928  IPR030560  
  • Prosite: PS00571
  • STRING: ENSP00000243167
• Other Databases: GeneCards:  FAAH  Malacards:  FAAH

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0009062	fatty acid catabolic process	IBA	biological process
GO:0017064	fatty acid amide hydrolase activity	IBA	molecular function
GO:0004040	amidase activity	IBA	molecular function
GO:0031090	organelle membrane	ISS	cellular component
GO:0103073	anandamide amidohydrolase activity	ISS	molecular function
GO:0047372	acylglycerol lipase activity	ISS	molecular function
GO:0052651	monoacylglycerol catabolic process	ISS	biological process
GO:0017064	fatty acid amide hydrolase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016042	lipid catabolic process	IEA	biological process
GO:0103073	anandamide amidohydrolase activity	IEA	molecular function
GO:0102077	oleamide hydrolase activity	IEA	molecular function
GO:0017064	fatty acid amide hydrolase activity	TAS	molecular function
GO:0019369	arachidonic acid metabolic process	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0047372	acylglycerol lipase activity	IEA	molecular function
GO:0012505	endomembrane system	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0009062	fatty acid catabolic process	IDA	biological process
GO:0017064	fatty acid amide hydrolase activity	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04723	Retrograde endocannabinoid signaling

Diseases

Associated diseases	References
obesity	PMID:15809662
Cryptorchidism	MIK: 28606200
Male infertility	MIK: 18987328
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R
18987328	Male infertility				Male infertility