• Gene id: 2152

Gene Summary

• Gene Symbol: F3   Gene   UCSC   Ensembl
• Aliases: CD142, TF, TFA
• Gene name: coagulation factor III, tissue factor
• Alternate names: tissue factor, coagulation factor III (thromboplastin, tissue factor),
• Gene location: 1p21.3 (137459333: 137447569)     Exons: 17     NC_000009.12
• Gene summary(Entrez): This gene encodes coagulation factor III which is a cell surface glycoprotein. This factor enables cells to initiate the blood coagulation cascades, and it functions as the high-affinity receptor for the coagulation factor VII. The resulting complex provi
• OMIM: 134390

Protein Summary

• Protein general information: P13726  
  • Name: Tissue factor (TF) (Coagulation factor III) (Thromboplastin) (CD antigen CD142)
  • Length: 295  
  • Mass: 33,068
• Sequence:

  METPAWPRVPRPETAVARTLLLGWVFAQVAGASGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSG
  DWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQ
  VGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVI
  PSRTVNRKSTDSPVECMGQEKGEFREIFYIIGAVVFVVIILVIILAISLHKCRKAGVGQSWKENSPLNVS

• Structural information:
  • Interpro: IPR003961  IPR036116  IPR013783  IPR015373  IPR001187   IPR030472  
  • Prosite: PS00621
  • PDB: 1AHW 1BOY 1DAN 1FAK 1J9C 1JPS 1NL8 1O5D 1TFH 1UJ3 1W0Y 1W2K 1WQV 1WSS 1WTG 1WUN 1WV7 1Z6J 2A2Q 2AEI 2AER 2B7D 2B8O 2C4F 2CEF 2CEH 2CEZ 2CFJ 2EC9 2F9B 2FIR 2FLB 2FLR 2HFT 2PUQ 2ZP0 2ZWL 2ZZU 3ELA 3TH2 3TH3 3TH4 4IBL 4M7L 4YLQ 4Z6A 4ZMA 5W06
  • PDBsum: 1AHW 1BOY 1DAN 1FAK 1J9C 1JPS 1NL8 1O5D 1TFH 1UJ3 1W0Y 1W2K 1WQV 1WSS 1WTG 1WUN 1WV7 1Z6J 2A2Q 2AEI 2AER 2B7D 2B8O 2C4F 2CEF 2CEH 2CEZ 2CFJ 2EC9 2F9B 2FIR 2FLB 2FLR 2HFT 2PUQ 2ZP0 2ZWL 2ZZU 3ELA 3TH2 3TH3 3TH4 4IBL 4M7L 4YLQ 4Z6A 4ZMA 5W06
  • DIP: 6136
  • STRING: ENSP00000334145
• Other Databases: GeneCards:  F3  Malacards:  F3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001938	positive regulation of endothelial cell proliferation	IDA	biological process
GO:0002020	protease binding	IPI	molecular function
GO:0002541	activation of plasma proteins involved in acute inflammatory response	IDA	biological process
GO:0002543	activation of blood coagulation via clotting cascade	IC	biological process
GO:0004896	cytokine receptor activity	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005543	phospholipid binding	IDA	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0007568	aging	IEA	biological process
GO:0007596	blood coagulation	IDA	biological process
GO:0007598	blood coagulation, extrinsic pathway	TAS	biological process
GO:0009266	response to temperature stimulus	IEA	biological process
GO:0009612	response to mechanical stimulus	IEA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0010641	positive regulation of platelet-derived growth factor receptor signaling pathway	IDA	biological process
GO:0014911	positive regulation of smooth muscle cell migration	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0019221	cytokine-mediated signaling pathway	IBA	biological process
GO:0030335	positive regulation of cell migration	TAS	biological process
GO:0031012	extracellular matrix	IDA	cellular component
GO:0031233	intrinsic component of external side of plasma membrane	IC	cellular component
GO:0032355	response to estradiol	IEA	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0034405	response to fluid shear stress	IEA	biological process
GO:0045766	positive regulation of angiogenesis	IDA	biological process
GO:0050927	positive regulation of positive chemotaxis	IC	biological process
GO:0051897	positive regulation of protein kinase B signaling	IMP	biological process
GO:0055098	response to low-density lipoprotein particle	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070301	cellular response to hydrogen peroxide	IEA	biological process
GO:0001938	positive regulation of endothelial cell proliferation	IDA	biological process
GO:0002020	protease binding	IEA	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0002541	activation of plasma proteins involved in acute inflammatory response	IDA	biological process
GO:0002543	activation of blood coagulation via clotting cascade	IC	biological process
GO:0004896	cytokine receptor activity	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005543	phospholipid binding	IDA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0005886	plasma membrane	NAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0007568	aging	IEA	biological process
GO:0007596	blood coagulation	IEA	biological process
GO:0007596	blood coagulation	IEA	biological process
GO:0007596	blood coagulation	IDA	biological process
GO:0007598	blood coagulation, extrinsic pathway	TAS	biological process
GO:0007599	hemostasis	IEA	biological process
GO:0009266	response to temperature stimulus	IEA	biological process
GO:0009611	response to wounding	IEA	biological process
GO:0009612	response to mechanical stimulus	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0010641	positive regulation of platelet-derived growth factor receptor signaling pathway	IDA	biological process
GO:0014911	positive regulation of smooth muscle cell migration	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	IBA	biological process
GO:0030335	positive regulation of cell migration	TAS	biological process
GO:0031012	extracellular matrix	IDA	cellular component
GO:0031233	intrinsic component of external side of plasma membrane	IC	cellular component
GO:0032355	response to estradiol	IEA	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0034405	response to fluid shear stress	IEA	biological process
GO:0045766	positive regulation of angiogenesis	IDA	biological process
GO:0050927	positive regulation of positive chemotaxis	IC	biological process
GO:0051897	positive regulation of protein kinase B signaling	IMP	biological process
GO:0055098	response to low-density lipoprotein particle	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070301	cellular response to hydrogen peroxide	IEA	biological process
GO:0001938	positive regulation of endothelial cell proliferation	IDA	biological process
GO:0002020	protease binding	IPI	molecular function
GO:0002541	activation of plasma proteins involved in acute inflammatory response	IDA	biological process
GO:0002543	activation of blood coagulation via clotting cascade	IC	biological process
GO:0004896	cytokine receptor activity	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005543	phospholipid binding	IDA	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0005886	plasma membrane	NAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0007596	blood coagulation	IDA	biological process
GO:0007598	blood coagulation, extrinsic pathway	TAS	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0010641	positive regulation of platelet-derived growth factor receptor signaling pathway	IDA	biological process
GO:0016021	integral component of membrane	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	IBA	biological process
GO:0030335	positive regulation of cell migration	TAS	biological process
GO:0031012	extracellular matrix	IDA	cellular component
GO:0031233	intrinsic component of external side of plasma membrane	IC	cellular component
GO:0045766	positive regulation of angiogenesis	IDA	biological process
GO:0050927	positive regulation of positive chemotaxis	IC	biological process
GO:0051897	positive regulation of protein kinase B signaling	IMP	biological process
GO:0070062	extracellular exosome	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa00380	Tryptophan metabolism
hsa04012	ErbB signaling pathway
hsa04610	Complement and coagulation cascades
hsa04933	AGE-RAGE signaling pathway in diabetic complications

Diseases

Associated diseases	References
Acute coronary syndrome	GAD: 16239598
Atherosclerosis	GAD: 18848323
Brain ischemia	GAD: 18622144
Cardiovascular disease	GAD: 16239598
Albuminuria	GAD: 17903292
Metabolic syndrome	GAD: 19056482
Diabetes	GAD: 17334638
Alzheimer's disease	GAD: 19141999
Kidney diseases	GAD: 19578796
Chronic renal failure	GAD: 21085059
Polycystic ovary syndrome (PCOS)	INFBASE: 22327820
Endometriosis	INFBASE: 9102363
Polycystic ovary syndrome (PCOS)	INFBASE: 23900753
Male factor infertility	MIK: 18395717
Chorioamnionitis	GAD: 20673868
Male infertility	MIK: 18395717
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
18395717	Male infertility			315 (127 infertile men (including 97 with idiopathic infertility), 188 controls)	Male infertility	HFE TF
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)