• Gene id: 2149

Gene Summary

• Gene Symbol: F2R   Gene   UCSC   Ensembl
• Aliases: CF2R, HTR, PAR-1, PAR1, TR
• Gene name: coagulation factor II thrombin receptor
• Alternate names: proteinase-activated receptor 1, protease-activated receptor 1,
• Gene location: 5q13.3 (76716042: 76735779)     Exons: 3     NC_000005.10
• Gene summary(Entrez): Coagulation factor II receptor is a 7-transmembrane receptor involved in the regulation of thrombotic response. Proteolytic cleavage leads to the activation of the receptor. F2R is a G-protein coupled receptor family member. Alternative splicing results i
• OMIM: 187930

Protein Summary

• Protein general information: P25116  
  • Name: Proteinase activated receptor 1 (PAR 1) (Coagulation factor II receptor) (Thrombin receptor)
  • Length: 425  
  • Mass: 47,441
• Sequence:

  MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPRSFLLRNPNDKYEPFWEDEEKNESGLTEYRLVSIN
  KSSPLQKQLPAFISEDASGYLTSSWLTLFVPSVYTGVFVVSLPLNIMAIVVFILKMKVKKPAVVYMLHLATADVL
  FVSVLPFKISYYFSGSDWQFGSELCRFVTAAFYCNMYASILLMTVISIDRFLAVVYPMQSLSWRTLGRASFTCLA
  IWALAIAGVVPLLLKEQTIQVPGLNITTCHDVLNETLLEGYYAYYFSAFSAVFFFVPLIISTVCYVSIIRCLSSS
  AVANRSKKSRALFLSAAVFCIFIICFGPTNVLLIAHYSFLSHTSTTEAAYFAYLLCVCVSSISCCIDPLIYYYAS
  SECQRYVYSILCCKESSDPSSYNSSGQLMASKMDTCSSNLNNSIYKKLLT

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR003912  IPR000935  
  • Prosite: PS00237 PS50262
  • CDD: cd15369
  • PDB: 1NRN 1NRO 1NRP 1NRQ 1NRR 3BEF 3HKI 3HKJ 3LU9 3VW7
  • PDBsum: 1NRN 1NRO 1NRP 1NRQ 1NRR 3BEF 3HKI 3HKJ 3LU9 3VW7
  • DIP: 29703
  • STRING: ENSP00000321326
• Other Databases: GeneCards:  F2R  Malacards:  F2R

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000186	activation of MAPKK activity	ISS	biological process
GO:0001965	G-protein alpha-subunit binding	ISS	molecular function
GO:0002248	connective tissue replacement involved in inflammatory response wound healing	IDA	biological process
GO:0003105	negative regulation of glomerular filtration	ISS	biological process
GO:0004930	G-protein coupled receptor activity	ISS	molecular function
GO:0004930	G-protein coupled receptor activity	TAS	molecular function
GO:0004930	G-protein coupled receptor activity	TAS	molecular function
GO:0004930	G-protein coupled receptor activity	TAS	molecular function
GO:0005102	receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0005770	late endosome	IDA	cellular component
GO:0005794	Golgi apparatus	TAS	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005901	caveola	IDA	cellular component
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0006954	inflammatory response	ISS	biological process
GO:0007186	G-protein coupled receptor signaling pathway	ISS	biological process
GO:0007200	phospholipase C-activating G-protein coupled receptor signaling pathway	IDA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	ISS	biological process
GO:0007205	protein kinase C-activating G-protein coupled receptor signaling pathway	ISS	biological process
GO:0007260	tyrosine phosphorylation of STAT protein	IDA	biological process
GO:0007262	STAT protein import into nucleus	IDA	biological process
GO:0007529	establishment of synaptic specificity at neuromuscular junction	ISS	biological process
GO:0007596	blood coagulation	TAS	biological process
GO:0008284	positive regulation of cell proliferation	ISS	biological process
GO:0008285	negative regulation of cell proliferation	IDA	biological process
GO:0009611	response to wounding	IDA	biological process
GO:0009653	anatomical structure morphogenesis	TAS	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	ISS	biological process
GO:0015057	thrombin-activated receptor activity	IDA	molecular function
GO:0015057	thrombin-activated receptor activity	IDA	molecular function
GO:0030168	platelet activation	IDA	biological process
GO:0030168	platelet activation	TAS	biological process
GO:0030193	regulation of blood coagulation	IDA	biological process
GO:0030194	positive regulation of blood coagulation	IDA	biological process
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0031094	platelet dense tubular network	IDA	cellular component
GO:0031594	neuromuscular junction	ISS	cellular component
GO:0031681	G-protein beta-subunit binding	ISS	molecular function
GO:0032496	response to lipopolysaccharide	ISS	biological process
GO:0032651	regulation of interleukin-1 beta production	ISS	biological process
GO:0032967	positive regulation of collagen biosynthetic process	IDA	biological process
GO:0035025	positive regulation of Rho protein signal transduction	ISS	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEP	biological process
GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0043524	negative regulation of neuron apoptotic process	ISS	biological process
GO:0045211	postsynaptic membrane	ISS	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045907	positive regulation of vasoconstriction	ISS	biological process
GO:0045987	positive regulation of smooth muscle contraction	ISS	biological process
GO:0046427	positive regulation of JAK-STAT cascade	IDA	biological process
GO:0048873	homeostasis of number of cells within a tissue	ISS	biological process
GO:0051209	release of sequestered calcium ion into cytosol	ISS	biological process
GO:0051281	positive regulation of release of sequestered calcium ion into cytosol	IDA	biological process
GO:0051482	positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G-protein coupled signaling pathway	ISS	biological process
GO:0051928	positive regulation of calcium ion transport	ISS	biological process
GO:0051930	regulation of sensory perception of pain	ISS	biological process
GO:0060155	platelet dense granule organization	IC	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:0070493	thrombin-activated receptor signaling pathway	IEA	biological process
GO:1900134	negative regulation of renin secretion into blood stream	ISS	biological process
GO:2000484	positive regulation of interleukin-8 secretion	IDA	biological process
GO:2000778	positive regulation of interleukin-6 secretion	IDA	biological process
GO:0000186	activation of MAPKK activity	ISS	biological process
GO:0001965	G-protein alpha-subunit binding	IEA	molecular function
GO:0001965	G-protein alpha-subunit binding	ISS	molecular function
GO:0002248	connective tissue replacement involved in inflammatory response wound healing	IDA	biological process
GO:0003105	negative regulation of glomerular filtration	ISS	biological process
GO:0004871	signal transducer activity	IEA	molecular function
GO:0004930	G-protein coupled receptor activity	IEA	molecular function
GO:0004930	G-protein coupled receptor activity	IEA	molecular function
GO:0004930	G-protein coupled receptor activity	ISS	molecular function
GO:0004930	G-protein coupled receptor activity	IEA	molecular function
GO:0004930	G-protein coupled receptor activity	TAS	molecular function
GO:0004930	G-protein coupled receptor activity	TAS	molecular function
GO:0004930	G-protein coupled receptor activity	TAS	molecular function
GO:0005102	receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0005770	late endosome	IDA	cellular component
GO:0005794	Golgi apparatus	TAS	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005901	caveola	IDA	cellular component
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0006954	inflammatory response	ISS	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IEA	biological process
GO:0007186	G-protein coupled receptor signaling pathway	ISS	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IEA	biological process
GO:0007200	phospholipase C-activating G-protein coupled receptor signaling pathway	IDA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IEA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	ISS	biological process
GO:0007205	protein kinase C-activating G-protein coupled receptor signaling pathway	ISS	biological process
GO:0007260	tyrosine phosphorylation of STAT protein	IDA	biological process
GO:0007262	STAT protein import into nucleus	IDA	biological process
GO:0007529	establishment of synaptic specificity at neuromuscular junction	ISS	biological process
GO:0007596	blood coagulation	IEA	biological process
GO:0007596	blood coagulation	IEA	biological process
GO:0007596	blood coagulation	TAS	biological process
GO:0007599	hemostasis	IEA	biological process
GO:0008284	positive regulation of cell proliferation	ISS	biological process
GO:0008285	negative regulation of cell proliferation	IDA	biological process
GO:0009611	response to wounding	IDA	biological process
GO:0009653	anatomical structure morphogenesis	TAS	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IEA	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	ISS	biological process
GO:0015057	thrombin-activated receptor activity	IEA	molecular function
GO:0015057	thrombin-activated receptor activity	IDA	molecular function
GO:0015057	thrombin-activated receptor activity	IDA	molecular function
GO:0015057	thrombin-activated receptor activity	TAS	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0030168	platelet activation	IDA	biological process
GO:0030168	platelet activation	TAS	biological process
GO:0030193	regulation of blood coagulation	IDA	biological process
GO:0030194	positive regulation of blood coagulation	IEA	biological process
GO:0030194	positive regulation of blood coagulation	IDA	biological process
GO:0030335	positive regulation of cell migration	IEA	biological process
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0031094	platelet dense tubular network	IDA	cellular component
GO:0031594	neuromuscular junction	ISS	cellular component
GO:0031681	G-protein beta-subunit binding	IEA	molecular function
GO:0031681	G-protein beta-subunit binding	ISS	molecular function
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0032496	response to lipopolysaccharide	ISS	biological process
GO:0032651	regulation of interleukin-1 beta production	IEA	biological process
GO:0032651	regulation of interleukin-1 beta production	ISS	biological process
GO:0032967	positive regulation of collagen biosynthetic process	IDA	biological process
GO:0035025	positive regulation of Rho protein signal transduction	IEA	biological process
GO:0035025	positive regulation of Rho protein signal transduction	ISS	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEP	biological process
GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0043524	negative regulation of neuron apoptotic process	ISS	biological process
GO:0045211	postsynaptic membrane	ISS	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045907	positive regulation of vasoconstriction	IEA	biological process
GO:0045907	positive regulation of vasoconstriction	ISS	biological process
GO:0045987	positive regulation of smooth muscle contraction	ISS	biological process
GO:0046427	positive regulation of JAK-STAT cascade	IDA	biological process
GO:0048873	homeostasis of number of cells within a tissue	IEA	biological process
GO:0048873	homeostasis of number of cells within a tissue	ISS	biological process
GO:0051209	release of sequestered calcium ion into cytosol	ISS	biological process
GO:0051281	positive regulation of release of sequestered calcium ion into cytosol	IDA	biological process
GO:0051482	positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G-protein coupled signaling pathway	ISS	biological process
GO:0051928	positive regulation of calcium ion transport	ISS	biological process
GO:0051930	regulation of sensory perception of pain	ISS	biological process
GO:0060155	platelet dense granule organization	IC	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:0070493	thrombin-activated receptor signaling pathway	IEA	biological process
GO:0070493	thrombin-activated receptor signaling pathway	IEA	biological process
GO:1900134	negative regulation of renin secretion into blood stream	IEA	biological process
GO:1900134	negative regulation of renin secretion into blood stream	ISS	biological process
GO:2000484	positive regulation of interleukin-8 secretion	IDA	biological process
GO:2000778	positive regulation of interleukin-6 secretion	IDA	biological process
GO:0000186	activation of MAPKK activity	ISS	biological process
GO:0001965	G-protein alpha-subunit binding	ISS	molecular function
GO:0002248	connective tissue replacement involved in inflammatory response wound healing	IDA	biological process
GO:0003105	negative regulation of glomerular filtration	ISS	biological process
GO:0004930	G-protein coupled receptor activity	ISS	molecular function
GO:0004930	G-protein coupled receptor activity	TAS	molecular function
GO:0004930	G-protein coupled receptor activity	TAS	molecular function
GO:0004930	G-protein coupled receptor activity	TAS	molecular function
GO:0005102	receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0005770	late endosome	IDA	cellular component
GO:0005794	Golgi apparatus	TAS	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005901	caveola	IDA	cellular component
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0006954	inflammatory response	ISS	biological process
GO:0007186	G-protein coupled receptor signaling pathway	ISS	biological process
GO:0007200	phospholipase C-activating G-protein coupled receptor signaling pathway	IDA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	ISS	biological process
GO:0007205	protein kinase C-activating G-protein coupled receptor signaling pathway	ISS	biological process
GO:0007260	tyrosine phosphorylation of STAT protein	IDA	biological process
GO:0007262	STAT protein import into nucleus	IDA	biological process
GO:0007529	establishment of synaptic specificity at neuromuscular junction	ISS	biological process
GO:0007596	blood coagulation	TAS	biological process
GO:0008284	positive regulation of cell proliferation	ISS	biological process
GO:0008285	negative regulation of cell proliferation	IDA	biological process
GO:0009611	response to wounding	IDA	biological process
GO:0009653	anatomical structure morphogenesis	TAS	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	ISS	biological process
GO:0015057	thrombin-activated receptor activity	IDA	molecular function
GO:0015057	thrombin-activated receptor activity	IDA	molecular function
GO:0015057	thrombin-activated receptor activity	TAS	molecular function
GO:0030168	platelet activation	IDA	biological process
GO:0030168	platelet activation	TAS	biological process
GO:0030193	regulation of blood coagulation	IDA	biological process
GO:0030194	positive regulation of blood coagulation	IDA	biological process
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0031094	platelet dense tubular network	IDA	cellular component
GO:0031594	neuromuscular junction	ISS	cellular component
GO:0031681	G-protein beta-subunit binding	ISS	molecular function
GO:0032496	response to lipopolysaccharide	ISS	biological process
GO:0032651	regulation of interleukin-1 beta production	ISS	biological process
GO:0032967	positive regulation of collagen biosynthetic process	IDA	biological process
GO:0035025	positive regulation of Rho protein signal transduction	ISS	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEP	biological process
GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0043524	negative regulation of neuron apoptotic process	ISS	biological process
GO:0045211	postsynaptic membrane	ISS	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045907	positive regulation of vasoconstriction	ISS	biological process
GO:0045987	positive regulation of smooth muscle contraction	ISS	biological process
GO:0046427	positive regulation of JAK-STAT cascade	IDA	biological process
GO:0048873	homeostasis of number of cells within a tissue	ISS	biological process
GO:0051209	release of sequestered calcium ion into cytosol	ISS	biological process
GO:0051281	positive regulation of release of sequestered calcium ion into cytosol	IDA	biological process
GO:0051482	positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G-protein coupled signaling pathway	ISS	biological process
GO:0051928	positive regulation of calcium ion transport	ISS	biological process
GO:0051930	regulation of sensory perception of pain	ISS	biological process
GO:0060155	platelet dense granule organization	IC	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:1900134	negative regulation of renin secretion into blood stream	ISS	biological process
GO:2000484	positive regulation of interleukin-8 secretion	IDA	biological process
GO:2000778	positive regulation of interleukin-6 secretion	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04020	Calcium signaling pathway
hsa04072	Phospholipase D signaling pathway
hsa04024	cAMP signaling pathway
hsa04151	PI3K-Akt signaling pathway
hsa04080	Neuroactive ligand-receptor interaction
hsa04810	Regulation of actin cytoskeleton
hsa04610	Complement and coagulation cascades
hsa04611	Platelet activation
hsa05200	Pathways in cancer
hsa05130	Pathogenic Escherichia coli infection

Diseases

Associated diseases	References
Myocardial Infarction	GAD: 17347481
Cardiovascular disease	GAD: 17347481
Hemorrhage	GAD: 20691446
Endometriosis	INFBASE: 22201911
Maturation arrest	MIK: 10731529
Spermatogenesis defects	MIK: 28068922
Obstructive azoospermia	MIK: 10731529
Sertoli cell only syndrome (SCOS)	MIK: 10731529
Varicocele	MIK: 23603921
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Sertoli cell-only syndrome	MIK: 10731529
Maturation arrest	MIK: 10731529
Obstructive azoospermia	MIK: 10731529
Azoospermia	MIK: 10731529
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583
Varicocele	MIK: 23603921

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
23603921	Varicocele			26 (16 subfertile men diagnosed as VAR, 10 fertile men)	Male infertility
23603921	Varicocele			26 (16 subfertile men diagnosed with varicocele, 10 fertile men)	Male infertility
10731529	Sertoli cell-only syndrome, maturation arrest, obstructive azoospermia, azoospermia			33 (12 testicular biopsy specimens from patients with Sertoli cell-only syndrome, 9 from patients with maturation arrest, and 12 from patients with obstructive azoospermia and normal histologic findings)	Male infertility	hTERT hTR
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray