• Gene id: 2118

Gene Summary

• Gene Symbol: ETV4   Gene   UCSC   Ensembl
• Aliases: E1A-F, E1AF, PEA3, PEAS3
• Gene name: ETS variant transcription factor 4
• Alternate names: ETS translocation variant 4, ETS variant 4, EWS protein/E1A enhancer binding protein chimera, adenovirus E1A enhancer-binding protein, ets variant gene 4 (E1A enhancer-binding protein, E1AF), polyomavirus enhancer activator 3 homolog,
• Gene location: 17q21.31 (43546339: 43527842)     Exons: 14     NC_000017.11

Protein Summary

• Protein general information: P43268  
  • Name: ETS translocation variant 4 (Adenovirus E1A enhancer binding protein) (E1A F) (Polyomavirus enhancer activator 3 homolog) (Protein PEA3)
  • Length: 484  
  • Mass: 53938
• Sequence:

  MERRMKAGYLDQQVPYTFSSKSPGNGSLREALIGPLGKLMDPGSLPPLDSEDLFQDLSHFQETWLAEAQVPDSDE
  QFVPDFHSENLAFHSPTTRIKKEPQSPRTDPALSCSRKPPLPYHHGEQCLYSSAYDPPRQIAIKSPAPGALGQSP
  LQPFPRAEQRNFLRSSGTSQPHPGHGYLGEHSSVFQQPLDICHSFTSQGGGREPLPAPYQHQLSEPCPPYPQQSF
  KQEYHDPLYEQAGQPAVDQGGVNGHRYPGAGVVIKQEQTDFAYDSDVTGCASMYLHTEGFSGPSPGDGAMGYGYE
  KPLRPFPDDVCVVPEKFEGDIKQEGVGAFREGPPYQRRGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPE
  EVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCEPEALFSLAFPDNQRPALKAEFDRPVSE
  EDTVPLSHLDESPAYLPELAGPAQPFGPKGGYSY

• Structural information:
  • Interpro: IPR000418  IPR006715  IPR036388  IPR036390  
  • Prosite: PS00345 PS00346 PS50061
  • PDB: 4CO8 4UUV 5ILU
  • PDBsum: 4CO8 4UUV 5ILU
  • DIP: 748
  • STRING: ENSP00000321835
• Other Databases: GeneCards:  ETV4  Malacards:  ETV4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0030154	cell differentiation	IBA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	molecular function
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005730	nucleolus	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05202	Transcriptional misregulation in cancer

Diseases

Associated diseases	References
Prostate cancer	KEGG:H00024
Ewing sarcoma	KEGG:H00035
Prostate cancer	KEGG:H00024
Ewing sarcoma	KEGG:H00035
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881