• Gene id: 2113

Gene Summary

• Gene Symbol: ETS1   Gene   UCSC   Ensembl
• Aliases: ETS-1, EWSR2, c-ets-1, p54
• Gene name: ETS proto-oncogene 1, transcription factor
• Alternate names: protein C-ets-1, Avian erythroblastosis virus E26 (v-ets) oncogene homolog-1, v-ets avian erythroblastosis virus E2 oncogene homolog 1, v-ets avian erythroblastosis virus E26 oncogene homolog 1,
• Gene location: 11q24.3 (128587592: 128458760)     Exons: 12     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the ETS family of transcription factors, which are defined by the presence of a conserved ETS DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T in target genes. These proteins function either as transc
• OMIM: 164720

Protein Summary

• Protein general information: P14921  
  • Name: Protein C ets 1 (p54)
  • Length: 441  
  • Mass: 50408
  • Tissue specificity: Highly expressed within lymphoid cells. Isoforms c-ETS-1A and Ets-1 p27 are both detected in all fetal tissues tested, but vary with tissue type in adult tissues. None is detected in brain or kidney. {ECO
• Sequence:

  MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTET
  HVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYP
  ESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFA
  IKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYPAALPNHKP
  KGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRW
  GKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDADE

• Structural information:
  • Protein Domains: (51..13-)
    (/note="PNT-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00762"-)
  • Interpro: IPR000418  IPR003118  IPR013761  IPR041886  IPR016311   IPR036388  IPR036390  
  • Prosite: PS00345 PS00346 PS50061 PS51433
  • CDD: cd08542
  • PDB: 1GVJ 2NNY 2STT 2STW 3MFK 3RI4 3WTS 3WTT 3WTU 3WTV 3WTW 3WTX 3WTY 3WTZ 3WU0 3WU1 4L0Y 4L0Z 4L18 4LG0 5ZMC
  • PDBsum: 1GVJ 2NNY 2STT 2STW 3MFK 3RI4 3WTS 3WTT 3WTU 3WTV 3WTW 3WTX 3WTY 3WTZ 3WU0 3WU1 4L0Y 4L0Z 4L18 4LG0 5ZMC
  • DIP: 35183
  • STRING: ENSP00000376436
• Other Databases: GeneCards:  ETS1  Malacards:  ETS1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0030154	cell differentiation	IBA	biological process
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0010595	positive regulation of endothelial cell migration	IMP	biological process
GO:0045765	regulation of angiogenesis	IMP	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0042025	host cell nucleus	IEA	cellular component
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006955	immune response	TAS	biological process
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0070555	response to interleukin-1	IEA	biological process
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0035035	histone acetyltransferase binding	IEA	molecular function
GO:0032355	response to estradiol	IEA	biological process
GO:0030335	positive regulation of cell migration	IEA	biological process
GO:0021983	pituitary gland development	IEA	biological process
GO:0021854	hypothalamus development	IEA	biological process
GO:0010715	regulation of extracellular matrix disassembly	IEA	biological process
GO:0009612	response to mechanical stimulus	IEA	biological process
GO:0009611	response to wounding	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0007565	female pregnancy	IEA	biological process
GO:0001666	response to hypoxia	IEA	biological process
GO:1990837	sequence-specific double-stranded DNA binding	IEA	molecular function
GO:0050728	negative regulation of inflammatory response	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005667	transcription regulator complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0070301	cellular response to hydrogen peroxide	IEA	biological process
GO:0060055	angiogenesis involved in wound healing	IEA	biological process
GO:0045766	positive regulation of angiogenesis	IEA	biological process
GO:0044849	estrous cycle	IEA	biological process
GO:0034616	response to laminar fluid shear stress	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0043536	positive regulation of blood vessel endothelial cell migration	IMP	biological process
GO:0003700	DNA-binding transcription factor activity	IDA	molecular function
GO:0003700	DNA-binding transcription factor activity	IDA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0048870	cell motility	IMP	biological process
GO:0051272	positive regulation of cellular component movement	IMP	biological process
GO:0050729	positive regulation of inflammatory response	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0030578	PML body organization	IDA	biological process
GO:0030578	PML body organization	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:1904996	positive regulation of leukocyte adhesion to vascular endothelial cell	IMP	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:1902895	positive regulation of pri-miRNA transcription by RNA polymerase II	IDA	biological process
GO:0045766	positive regulation of angiogenesis	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0045648	positive regulation of erythrocyte differentiation	IDA	biological process
GO:0008134	transcription factor binding	NAS	molecular function
GO:0003677	DNA binding	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04014	Ras signaling pathway
hsa05166	Human T-cell leukemia virus 1 infection
hsa04218	Cellular senescence
hsa05211	Renal cell carcinoma

Diseases

Associated diseases	References
type 2 diabetes mellitus	PMID:19225563
type 1 diabetes mellitus	PMID:1686010
type 1 diabetes mellitus	PMID:1982251
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray