• Gene id: 2098

Gene Summary

• Gene Symbol: ESD   Gene   UCSC   Ensembl
• Aliases: FGH
• Gene name: esterase D
• Alternate names: S-formylglutathione hydrolase, esterase 10, esterase D/formylglutathione hydrolase, methylumbelliferyl-acetate deacetylase, testicular tissue protein Li 66,
• Gene location: 13q14.2 (46797699: 46771255)     Exons: 10     NC_000013.11
• Gene summary(Entrez): This gene encodes a serine hydrolase that belongs to the esterase D family. The encoded enzyme is active toward numerous substrates including O-acetylated sialic acids, and it may be involved in the recycling of sialic acids. This gene is used as a geneti
• OMIM: 133280

Protein Summary

• Protein general information: P10768  
  • Name: S formylglutathione hydrolase (FGH) (EC 3.1.2.12) (Esterase D) (Methylumbelliferyl acetate deacetylase) (EC 3.1.1.56)
  • Length: 282  
  • Mass: 31463
• Sequence:

  MALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETGKCPALYWLSGLTCTEQNFISKSGYHQSASEHG
  LVVIAPDTSPRGCNIKGEDESWDFGTGAGFYVDATEDPWKTNYRMYSYVTEELPQLINANFPVDPQRMSIFGHSM
  GGHGALICALKNPGKYKSVSAFAPICNPVLCPWGKKAFSGYLGTDQSKWKAYDATHLVKSYPGSQLDILIDQGKD
  DQFLLDGQLLPDNFIAACTEKKIPVVFRLQEGYDHSYYFIATFITDHIRHHAKYLNA

• Structural information:
  • Interpro: IPR029058  IPR000801  IPR014186  
  • PDB: 3FCX
  • PDBsum: 3FCX
  • STRING: ENSP00000367992
• Other Databases: GeneCards:  ESD  Malacards:  ESD

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0018738	S-formylglutathione hydrolase activity	IBA	molecular function
GO:0046294	formaldehyde catabolic process	IEA	biological process
GO:0018738	S-formylglutathione hydrolase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0052689	carboxylic ester hydrolase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0018738	S-formylglutathione hydrolase activity	IEA	molecular function
GO:0047374	methylumbelliferyl-acetate deacetylase activity	IEA	molecular function
GO:1901687	glutathione derivative biosynthetic process	TAS	biological process
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016788	hydrolase activity, acting on ester bonds	IDA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0052689	carboxylic ester hydrolase activity	NAS	molecular function
GO:0008150	biological_process	ND	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa01200	Carbon metabolism

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)