• Gene id: 208

Gene Summary

• Gene Symbol: AKT2   Gene   UCSC   Ensembl
• Aliases: HIHGHH, PKBB, PKBBETA, PRKBB, RAC-BETA
• Gene name: AKT serine/threonine kinase 2
• Alternate names: RAC-beta serine/threonine-protein kinase, PKB beta, RAC-PK-beta, murine thymoma viral (v-akt) homolog-2, protein kinase Akt-2, protein kinase B beta, putative v-akt murine thymoma viral oncoprotein 2, rac protein kinase beta, v-akt murine thymoma viral oncogene h,
• Gene location: 19q13.2 (40285530: 40230316)     Exons: 22     NC_000019.10
• Gene summary(Entrez): This gene is a putative oncogene encoding a protein belonging to a subfamily of serine/threonine kinases containing SH2-like (Src homology 2-like) domains, which is involved in signaling pathways. The gene serves as an oncogene in the tumorigenesis of can
• OMIM: 600047

Protein Summary

• Protein general information: P31751  
  • Name: RAC beta serine/threonine protein kinase (EC 2.7.11.1) (Protein kinase Akt 2) (Protein kinase B beta) (PKB beta) (RAC PK beta)
  • Length: 481  
  • Mass: 55769
  • Tissue specificity: Expressed in all cell types so far analyzed.
• Sequence:

  MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAECQLMKTERPRPNTFVI
  RCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMN
  DFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRL
  CFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
  ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSP
  EAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDDEFTAQSITI
  TPPDRYDSLGLLELDQRTHFPQFSYSASIRE

• Structural information:
  • Protein Domains: (5..10-)
    (/note="PH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00145-)
    (152..40-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159-)
    (410..48-)
    (/note="AGC-kinase-C-terminal")
  • Interpro: IPR000961  IPR034677  IPR011009  IPR011993  IPR001849   IPR039026  IPR017892  IPR000719  IPR017441  IPR008271  
  • Prosite: PS51285 PS50003 PS00107 PS50011 PS00108
  • CDD: cd01241 cd05595
  • PDB: 1GZK 1GZN 1GZO 1MRV 1MRY 1O6K 1O6L 1P6S 2JDO 2JDR 2UW9 2X39 2XH5 3D0E 3E87 3E88 3E8D
  • PDBsum: 1GZK 1GZN 1GZO 1MRV 1MRY 1O6K 1O6L 1P6S 2JDO 2JDR 2UW9 2X39 2XH5 3D0E 3E87 3E88 3E8D
  • DIP: 32583
  • STRING: ENSP00000375892
• Other Databases: GeneCards:  AKT2  Malacards:  AKT2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0018105	peptidyl-serine phosphorylation	IBA	biological process
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005524	ATP binding	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0045444	fat cell differentiation	TAS	biological process
GO:0032587	ruffle membrane	ISS	cellular component
GO:0030334	regulation of cell migration	TAS	biological process
GO:0008286	insulin receptor signaling pathway	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0005938	cell cortex	ISS	cellular component
GO:0090314	positive regulation of protein targeting to membrane	ISS	biological process
GO:0071156	regulation of cell cycle arrest	TAS	biological process
GO:0065002	intracellular protein transmembrane transport	ISS	biological process
GO:0060644	mammary gland epithelial cell differentiation	TAS	biological process
GO:0031340	positive regulation of vesicle fusion	ISS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0001934	positive regulation of protein phosphorylation	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0005978	glycogen biosynthetic process	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0016301	kinase activity	IEA	molecular function
GO:0006006	glucose metabolic process	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0005977	glycogen metabolic process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0006417	regulation of translation	IEA	biological process
GO:0008643	carbohydrate transport	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0006464	cellular protein modification process	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0097473	retinal rod cell apoptotic process	IEA	biological process
GO:0090630	activation of GTPase activity	IEA	biological process
GO:0072659	protein localization to plasma membrane	IEA	biological process
GO:0071486	cellular response to high light intensity	IEA	biological process
GO:0032869	cellular response to insulin stimulus	IEA	biological process
GO:0032587	ruffle membrane	IEA	cellular component
GO:0008286	insulin receptor signaling pathway	IEA	biological process
GO:0006006	glucose metabolic process	IEA	biological process
GO:0005938	cell cortex	IEA	cellular component
GO:0090314	positive regulation of protein targeting to membrane	IEA	biological process
GO:0065002	intracellular protein transmembrane transport	IEA	biological process
GO:0046326	positive regulation of glucose import	IEA	biological process
GO:0032287	peripheral nervous system myelin maintenance	IEA	biological process
GO:0031340	positive regulation of vesicle fusion	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0001934	positive regulation of protein phosphorylation	IEA	biological process
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0008286	insulin receptor signaling pathway	IMP	biological process
GO:0010907	positive regulation of glucose metabolic process	IMP	biological process
GO:0032869	cellular response to insulin stimulus	IMP	biological process
GO:2000147	positive regulation of cell motility	IMP	biological process
GO:0010748	negative regulation of long-chain fatty acid import across plasma membrane	IMP	biological process
GO:0032000	positive regulation of fatty acid beta-oxidation	IMP	biological process
GO:0045725	positive regulation of glycogen biosynthetic process	IMP	biological process
GO:0046326	positive regulation of glucose import	IMP	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0032991	protein-containing complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0010918	positive regulation of mitochondrial membrane potential	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05168	Herpes simplex virus 1 infection
hsa05010	Alzheimer disease
hsa04151	PI3K-Akt signaling pathway
hsa05165	Human papillomavirus infection
hsa04010	MAPK signaling pathway
hsa05131	Shigellosis
hsa04014	Ras signaling pathway
hsa05132	Salmonella infection
hsa04015	Rap1 signaling pathway
hsa04024	cAMP signaling pathway
hsa05166	Human T-cell leukemia virus 1 infection
hsa05163	Human cytomegalovirus infection
hsa04062	Chemokine signaling pathway
hsa04510	Focal adhesion
hsa05170	Human immunodeficiency virus 1 infection
hsa05205	Proteoglycans in cancer
hsa05169	Epstein-Barr virus infection
hsa04022	cGMP-PKG signaling pathway
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa04150	mTOR signaling pathway
hsa05225	Hepatocellular carcinoma
hsa05017	Spinocerebellar ataxia
hsa04261	Adrenergic signaling in cardiomyocytes
hsa04072	Phospholipase D signaling pathway
hsa04140	Autophagy - animal
hsa05152	Tuberculosis
hsa04932	Non-alcoholic fatty liver disease
hsa04630	JAK-STAT signaling pathway
hsa05164	Influenza A
hsa04371	Apelin signaling pathway
hsa04910	Insulin signaling pathway
hsa05226	Gastric cancer
hsa04218	Cellular senescence
hsa05161	Hepatitis B
hsa04728	Dopaminergic synapse
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa05224	Breast cancer
hsa04380	Osteoclast differentiation
hsa05160	Hepatitis C
hsa05418	Fluid shear stress and atherosclerosis
hsa05135	Yersinia infection
hsa04611	Platelet activation
hsa04210	Apoptosis
hsa04926	Relaxin signaling pathway
hsa04722	Neurotrophin signaling pathway
hsa04071	Sphingolipid signaling pathway
hsa04725	Cholinergic synapse
hsa04152	AMPK signaling pathway
hsa04068	FoxO signaling pathway
hsa04935	Growth hormone synthesis, secretion and action
hsa05162	Measles
hsa04919	Thyroid hormone signaling pathway
hsa04915	Estrogen signaling pathway
hsa04922	Glucagon signaling pathway
hsa05231	Choline metabolism in cancer
hsa04668	TNF signaling pathway
hsa04625	C-type lectin receptor signaling pathway
hsa04660	T cell receptor signaling pathway
hsa04931	Insulin resistance
hsa04666	Fc gamma R-mediated phagocytosis
hsa04620	Toll-like receptor signaling pathway
hsa04066	HIF-1 signaling pathway
hsa05145	Toxoplasmosis
hsa04662	B cell receptor signaling pathway
hsa04914	Progesterone-mediated oocyte maturation
hsa05235	PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05142	Chagas disease
hsa05222	Small cell lung cancer
hsa04012	ErbB signaling pathway
hsa04211	Longevity regulating pathway
hsa04933	AGE-RAGE signaling pathway in diabetic complications
hsa01522	Endocrine resistance
hsa05210	Colorectal cancer
hsa05220	Chronic myeloid leukemia
hsa05215	Prostate cancer
hsa05214	Glioma
hsa04920	Adipocytokine signaling pathway
hsa04664	Fc epsilon RI signaling pathway
hsa05212	Pancreatic cancer
hsa01521	EGFR tyrosine kinase inhibitor resistance
hsa04917	Prolactin signaling pathway
hsa05221	Acute myeloid leukemia
hsa05211	Renal cell carcinoma
hsa05218	Melanoma
hsa05223	Non-small cell lung cancer
hsa04929	GnRH secretion
hsa04213	Longevity regulating pathway - multiple species
hsa04370	VEGF signaling pathway
hsa05213	Endometrial cancer
hsa04923	Regulation of lipolysis in adipocytes
hsa05230	Central carbon metabolism in cancer
hsa01524	Platinum drug resistance
hsa04973	Carbohydrate digestion and absorption

Diseases

Associated diseases	References
Ovarian cancer	KEGG:H00027
Familial partial lipodystrophy	KEGG:H00420
Hypoinsulinemic hypoglycemia with hemihypertrophy	KEGG:H01909
Ovarian cancer	KEGG:H00027
Familial partial lipodystrophy	KEGG:H00420
Hypoinsulinemic hypoglycemia with hemihypertrophy	KEGG:H01909
Prostate cancer	PMID:22815832
Prostate cancer	PMID:24838891
Endometrial cancer	PMID:22146979
prostate adenocarcinoma	PMID:20638364
Astrocytoma	PMID:20167810
Malignant glioma	PMID:19330838
ovarian carcinoma	PMID:16721043
colorectal cancer	PMID:11756242
type 2 diabetes mellitus	PMID:18204829
type 2 diabetes mellitus	PMID:18972094
type 2 diabetes mellitus	PMID:15166380
obesity	PMID:12663464
hypoglycemia	PMID:21979934
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq