• Gene id: 2079

Gene Summary

• Gene Symbol: ERH   Gene   UCSC   Ensembl
• Aliases: DROER
• Gene name: ERH mRNA splicing and mitosis factor
• Alternate names: enhancer of rudimentary homolog,
• Gene location: 14q24.1 (69398298: 69380127)     Exons: 4     NC_000014.9
• OMIM: 191290

Protein Summary

• Protein general information: P84090  
  • Name: Enhancer of rudimentary homolog
  • Length: 104  
  • Mass: 12259
  • Tissue specificity: Expressed in all tissues examined. {ECO
• Sequence:

  MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRAD
  TQTYQPYNKDWIKEKIYVLLRRQAQQAGK

• Structural information:
  • Interpro: IPR035912  IPR000781  
  • Prosite: PS01290
  • PDB: 1W9G 2NML
  • PDBsum: 1W9G 2NML
  • DIP: 42473
  • STRING: ENSP00000451080
• Other Databases: GeneCards:  ERH  Malacards:  ERH

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0034709	methylosome	IDA	cellular component
GO:0008327	methyl-CpG binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0006213	pyrimidine nucleoside metabolic process	TAS	biological process
GO:0006139	nucleobase-containing compound metabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030496	midbody	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881