• Gene id: 2078

Gene Summary

• Gene Symbol: ERG   Gene   UCSC   Ensembl
• Aliases: erg-3, p55
• Gene name: ETS transcription factor ERG
• Alternate names: transcriptional regulator ERG, ERG, ETS transcription factor, FUS/ERG fusion protein, TMPRSS2/ERG fusion, erythroblast transformation-specific transcription factor ERG variant 10, ets-related, transcriptional regulator ERG (transforming protein ERG), v-ets avian,
• Gene location: 21q22.2 (38661782: 38367260)     Exons: 17     NC_000021.9
• Gene summary(Entrez): This gene encodes a member of the erythroblast transformation-specific (ETS) family of transcriptions factors. All members of this family are key regulators of embryonic development, cell proliferation, differentiation, angiogenesis, inflammation, and apo
• OMIM: 601135

Protein Summary

• Protein general information: P11308  
  • Name: Transcriptional regulator ERG (Transforming protein ERG)
  • Length: 486  
  • Mass: 54608
• Sequence:

  MIQTVPDPAAHIKEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDYGQTSKMSPRVPQQDWLSQPPARVTIKM
  ECNPSQVNGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHMPPPNMTTNERRVIVPADPTLWSTDHVRQWL
  EWAVKEYGLPDVNILLFQNIDGKELCKMTKDDFQRLTPSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRL
  MHARNTGGAAFIFPNTSVYPEATQRITTRPDLPYEPPRRSAWTGHGHPTPQSKAAQPSPSTVPKTEDQRPQLDPY
  QILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRA
  LRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSYHAHPQKMNFVAPHPPALPVTSS
  SFFAAPNPYWNSPTGGIYPNTRLPTSHMPSHLGTYY

• Structural information:
  • Protein Domains: (120..20-)
    (/note="PNT-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00762"-)
  • Interpro: IPR000418  IPR003118  IPR013761  IPR036388  IPR036390  
  • Prosite: PS00345 PS00346 PS50061 PS51433
  • PDB: 1SXE 4IRG 4IRH 4IRI 5YBC 5YBD
  • PDBsum: 1SXE 4IRG 4IRH 4IRI 5YBC 5YBD
  • DIP: 31028
  • STRING: ENSP00000414150
• Other Databases: GeneCards:  ERG  Malacards:  ERG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0030154	cell differentiation	IBA	biological process
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0042025	host cell nucleus	IEA	cellular component
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0006468	protein phosphorylation	TAS	biological process
GO:0007275	multicellular organism development	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003682	chromatin binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:1990904	ribonucleoprotein complex	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05202	Transcriptional misregulation in cancer
hsa05215	Prostate cancer

Diseases

Associated diseases	References
Prostate cancer	KEGG:H00024
Ewing sarcoma	KEGG:H00035
Prostate cancer	KEGG:H00024
Ewing sarcoma	KEGG:H00035
myeloid leukemia	PMID:23719302
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq