• Gene id: 2069

Gene Summary

• Gene Symbol: EREG   Gene   UCSC   Ensembl
• Aliases: EPR, ER, Ep
• Gene name: epiregulin
• Alternate names: proepiregulin,
• Gene location: 4q13.3 (74365144: 74388748)     Exons: 27     NC_000004.12
• Gene summary(Entrez): This gene encodes a secreted peptide hormone and member of the epidermal growth factor (EGF) family of proteins. The encoded protein is a ligand of the epidermal growth factor receptor (EGFR) and the structurally related erb-b2 receptor tyrosine kinase 4
• OMIM: 602061

Protein Summary

• Protein general information: O14944  
  • Name: Proepiregulin [Cleaved into: Epiregulin (EPR)]
  • Length: 169  
  • Mass: 19044
  • Tissue specificity: In normal adults, expressed predominantly in the placenta and peripheral blood leukocytes. High levels were detected in carcinomas of the bladder, lung, kidney and colon. {ECO
• Sequence:

  MTAGRRMEMLCAGRVPALLLCLGFHLLQAVLSTTVIPSCIPGESSDNCTALVQTEDNPRVAQVSITKCSSDMNGY
  CLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFLTVHQPLSKEYVALTVILIILFLITVVGSTYYFCRWYRNRKSK
  EPKKEYERVTSGDPELPQV

• Structural information:
  • Protein Domains: (64..10-)
    (/note="EGF-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00076"-)
  • Interpro: IPR013032  IPR000742  
  • Prosite: PS00022 PS01186 PS50026
  • PDB: 1K36 1K37 5E8D 5WB7
  • PDBsum: 1K36 1K37 5E8D 5WB7
  • STRING: ENSP00000244869
• Other Databases: GeneCards:  EREG  Malacards:  EREG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007173	epidermal growth factor receptor signaling pathway	IBA	biological process
GO:0008083	growth factor activity	IBA	molecular function
GO:0045740	positive regulation of DNA replication	IBA	biological process
GO:0045741	positive regulation of epidermal growth factor-activated receptor activity	IBA	biological process
GO:0045840	positive regulation of mitotic nuclear division	IBA	biological process
GO:0005154	epidermal growth factor receptor binding	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0008284	positive regulation of cell population proliferation	IBA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0051781	positive regulation of cell division	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0008083	growth factor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0000165	MAPK cascade	TAS	biological process
GO:0007173	epidermal growth factor receptor signaling pathway	TAS	biological process
GO:0042059	negative regulation of epidermal growth factor receptor signaling pathway	TAS	biological process
GO:0051897	positive regulation of protein kinase B signaling	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0038128	ERBB2 signaling pathway	TAS	biological process
GO:0061024	membrane organization	TAS	biological process
GO:2000145	regulation of cell motility	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008083	growth factor activity	IEA	molecular function
GO:0042327	positive regulation of phosphorylation	IEA	biological process
GO:0042700	luteinizing hormone signaling pathway	IEA	biological process
GO:0043434	response to peptide hormone	IEA	biological process
GO:0045740	positive regulation of DNA replication	IEA	biological process
GO:0045741	positive regulation of epidermal growth factor-activated receptor activity	IEA	biological process
GO:0045840	positive regulation of mitotic nuclear division	IEA	biological process
GO:0048661	positive regulation of smooth muscle cell proliferation	IEA	biological process
GO:0007173	epidermal growth factor receptor signaling pathway	IEA	biological process
GO:0045089	positive regulation of innate immune response	IEA	biological process
GO:0045410	positive regulation of interleukin-6 biosynthetic process	IEA	biological process
GO:0045740	positive regulation of DNA replication	IEA	biological process
GO:0045840	positive regulation of mitotic nuclear division	IEA	biological process
GO:0001550	ovarian cumulus expansion	IEA	biological process
GO:0001556	oocyte maturation	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0007143	female meiotic nuclear division	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0030728	ovulation	IEA	biological process
GO:0048160	primary follicle stage	IEA	biological process
GO:0001819	positive regulation of cytokine production	IEA	biological process
GO:0005154	epidermal growth factor receptor binding	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0051151	negative regulation of smooth muscle cell differentiation	IDA	biological process
GO:0043616	keratinocyte proliferation	IDA	biological process
GO:0042108	positive regulation of cytokine biosynthetic process	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0045740	positive regulation of DNA replication	IDA	biological process
GO:0042327	positive regulation of phosphorylation	IDA	biological process
GO:0009299	mRNA transcription	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0019221	cytokine-mediated signaling pathway	IDA	biological process
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0007267	cell-cell signaling	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0048146	positive regulation of fibroblast proliferation	IDA	biological process
GO:0045860	positive regulation of protein kinase activity	IDA	biological process
GO:0045740	positive regulation of DNA replication	IDA	biological process
GO:0042327	positive regulation of phosphorylation	IDA	biological process
GO:0048661	positive regulation of smooth muscle cell proliferation	ISS	biological process
GO:0045840	positive regulation of mitotic nuclear division	ISS	biological process
GO:0045840	positive regulation of mitotic nuclear division	ISS	biological process
GO:0045740	positive regulation of DNA replication	ISS	biological process
GO:0042327	positive regulation of phosphorylation	ISS	biological process
GO:0007173	epidermal growth factor receptor signaling pathway	ISS	biological process
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0050680	negative regulation of epithelial cell proliferation	TAS	biological process
GO:0042060	wound healing	TAS	biological process
GO:0009653	anatomical structure morphogenesis	TAS	biological process
GO:0008284	positive regulation of cell population proliferation	ISS	biological process
GO:0007143	female meiotic nuclear division	ISS	biological process
GO:0005154	epidermal growth factor receptor binding	ISS	molecular function
GO:0045741	positive regulation of epidermal growth factor-activated receptor activity	ISS	biological process
GO:0045740	positive regulation of DNA replication	ISS	biological process
GO:0045410	positive regulation of interleukin-6 biosynthetic process	ISS	biological process
GO:0045089	positive regulation of innate immune response	ISS	biological process
GO:0042700	luteinizing hormone signaling pathway	ISS	biological process
GO:0030216	keratinocyte differentiation	TAS	biological process
GO:0048160	primary follicle stage	ISS	biological process
GO:0030728	ovulation	ISS	biological process
GO:0009887	animal organ morphogenesis	TAS	biological process
GO:0008285	negative regulation of cell population proliferation	ISS	biological process
GO:0005154	epidermal growth factor receptor binding	TAS	molecular function
GO:0001819	positive regulation of cytokine production	ISS	biological process
GO:0001556	oocyte maturation	ISS	biological process
GO:0001550	ovarian cumulus expansion	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa04010	MAPK signaling pathway
hsa04012	ErbB signaling pathway
hsa05210	Colorectal cancer

Diseases

Associated diseases	References
Colorectal cancer	KEGG:H00020
Colorectal cancer	KEGG:H00020
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881