About Us

Search Result


Gene id 2067
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol ERCC1   Gene   UCSC   Ensembl
Aliases COFS4, RAD10, UV20
Gene name ERCC excision repair 1, endonuclease non-catalytic subunit
Alternate names DNA excision repair protein ERCC-1, excision repair cross-complementation group 1, excision repair cross-complementing rodent repair deficiency, complementation group 1 (includes overlapping antisense sequence),
Gene location 19q13.32 (45478865: 45407332)     Exons: 14     NC_000019.10
Gene summary(Entrez) The product of this gene functions in the nucleotide excision repair pathway, and is required for the repair of DNA lesions such as those induced by UV light or formed by electrophilic compounds including cisplatin. The encoded protein forms a heterodimer
OMIM 126380

Protein Summary

Protein general information P07992  

Name: DNA excision repair protein ERCC 1

Length: 297  Mass: 32,562

Sequence MDPGKDKEGVPQPSGPPARKKFVIPLDEDEVPPGVAKPLFRSTQSLPTVDTSAQAAPQTYAEYAISQPLEGAGAT
CPTGSEPLAGETPNQALKPGAKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHP
DYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPADLLME
KLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVP
Structural information
Interpro:  IPR004579  IPR011335  IPR010994  

PDB:  
1Z00 2A1I 2A1J 2JNW 2JPD 2MUT
PDBsum:   1Z00 2A1I 2A1J 2JNW 2JPD 2MUT

DIP:  

24235

MINT:  
STRING:   ENSP00000013807
Other Databases GeneCards:  ERCC1  Malacards:  ERCC1

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0000109 nucleotide-excision repai
r complex
IDA cellular component
GO:0000109 nucleotide-excision repai
r complex
IDA cellular component
GO:0000109 nucleotide-excision repai
r complex
IDA cellular component
GO:0000110 nucleotide-excision repai
r factor 1 complex
IDA cellular component
GO:0000720 pyrimidine dimer repair b
y nucleotide-excision rep
air
IEA biological process
GO:0000784 nuclear chromosome, telom
eric region
IDA cellular component
GO:0001094 TFIID-class transcription
factor binding
IEA molecular function
GO:0001302 replicative cell aging
IEA biological process
GO:0003684 damaged DNA binding
IDA molecular function
GO:0003697 single-stranded DNA bindi
ng
IDA molecular function
GO:0003697 single-stranded DNA bindi
ng
IDA molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005654 nucleoplasm
IDA cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005669 transcription factor TFII
D complex
IEA cellular component
GO:0005737 cytoplasm
IDA cellular component
GO:0006281 DNA repair
IMP biological process
GO:0006283 transcription-coupled nuc
leotide-excision repair
TAS biological process
GO:0006289 nucleotide-excision repai
r
IGI biological process
GO:0006289 nucleotide-excision repai
r
IDA biological process
GO:0006293 nucleotide-excision repai
r, preincision complex st
abilization
TAS biological process
GO:0006295 nucleotide-excision repai
r, DNA incision, 3'-to le
sion
IMP biological process
GO:0006295 nucleotide-excision repai
r, DNA incision, 3'-to le
sion
TAS biological process
GO:0006296 nucleotide-excision repai
r, DNA incision, 5'-to le
sion
IMP biological process
GO:0006296 nucleotide-excision repai
r, DNA incision, 5'-to le
sion
TAS biological process
GO:0006302 double-strand break repai
r
IEA biological process
GO:0006310 DNA recombination
IGI biological process
GO:0006312 mitotic recombination
IMP biological process
GO:0006949 syncytium formation
IEA biological process
GO:0006979 response to oxidative str
ess
IMP biological process
GO:0006979 response to oxidative str
ess
IMP biological process
GO:0007283 spermatogenesis
IEA biological process
GO:0007584 response to nutrient
IEA biological process
GO:0008022 protein C-terminus bindin
g
IPI molecular function
GO:0008283 cell proliferation
IEA biological process
GO:0008584 male gonad development
IEA biological process
GO:0009650 UV protection
IEA biological process
GO:0009744 response to sucrose
IEA biological process
GO:0010165 response to X-ray
IEA biological process
GO:0010259 multicellular organism ag
ing
IEA biological process
GO:0019904 protein domain specific b
inding
IPI molecular function
GO:0032205 negative regulation of te
lomere maintenance
IMP biological process
GO:0033683 nucleotide-excision repai
r, DNA incision
TAS biological process
GO:0035166 post-embryonic hemopoiesi
s
IEA biological process
GO:0035264 multicellular organism gr
owth
IEA biological process
GO:0036297 interstrand cross-link re
pair
TAS biological process
GO:0045190 isotype switching
IEA biological process
GO:0048477 oogenesis
IEA biological process
GO:0048568 embryonic organ developme
nt
IEA biological process
GO:0070522 ERCC4-ERCC1 complex
IDA cellular component
GO:0070911 global genome nucleotide-
excision repair
TAS biological process
GO:0090656 t-circle formation
ISS biological process
GO:1904431 positive regulation of t-
circle formation
ISS biological process
GO:0000014 single-stranded DNA endod
eoxyribonuclease activity
IDA molecular function
GO:0043566 structure-specific DNA bi
nding
IDA molecular function
GO:0000109 nucleotide-excision repai
r complex
IDA cellular component
GO:0000109 nucleotide-excision repai
r complex
IDA cellular component
GO:0000109 nucleotide-excision repai
r complex
IDA cellular component
GO:0000110 nucleotide-excision repai
r factor 1 complex
IDA cellular component
GO:0000720 pyrimidine dimer repair b
y nucleotide-excision rep
air
IEA biological process
GO:0000784 nuclear chromosome, telom
eric region
IDA cellular component
GO:0001094 TFIID-class transcription
factor binding
IEA molecular function
GO:0001302 replicative cell aging
IEA biological process
GO:0003677 DNA binding
IEA molecular function
GO:0003684 damaged DNA binding
IEA molecular function
GO:0003684 damaged DNA binding
IDA molecular function
GO:0003697 single-stranded DNA bindi
ng
IDA molecular function
GO:0003697 single-stranded DNA bindi
ng
IDA molecular function
GO:0004518 nuclease activity
IEA molecular function
GO:0004519 endonuclease activity
IEA molecular function
GO:0004519 endonuclease activity
IEA molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005634 nucleus
IEA cellular component
GO:0005634 nucleus
IEA cellular component
GO:0005634 nucleus
IEA cellular component
GO:0005634 nucleus
IEA cellular component
GO:0005654 nucleoplasm
IDA cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005669 transcription factor TFII
D complex
IEA cellular component
GO:0005737 cytoplasm
IEA cellular component
GO:0005737 cytoplasm
IEA cellular component
GO:0005737 cytoplasm
IDA cellular component
GO:0006281 DNA repair
IEA biological process
GO:0006281 DNA repair
IEA biological process
GO:0006281 DNA repair
IEA biological process
GO:0006281 DNA repair
IMP biological process
GO:0006283 transcription-coupled nuc
leotide-excision repair
TAS biological process
GO:0006289 nucleotide-excision repai
r
IEA biological process
GO:0006289 nucleotide-excision repai
r
IGI biological process
GO:0006289 nucleotide-excision repai
r
IDA biological process
GO:0006293 nucleotide-excision repai
r, preincision complex st
abilization
TAS biological process
GO:0006295 nucleotide-excision repai
r, DNA incision, 3'-to le
sion
IMP biological process
GO:0006295 nucleotide-excision repai
r, DNA incision, 3'-to le
sion
TAS biological process
GO:0006296 nucleotide-excision repai
r, DNA incision, 5'-to le
sion
IMP biological process
GO:0006296 nucleotide-excision repai
r, DNA incision, 5'-to le
sion
TAS biological process
GO:0006302 double-strand break repai
r
IEA biological process
GO:0006310 DNA recombination
IEA biological process
GO:0006310 DNA recombination
IGI biological process
GO:0006312 mitotic recombination
IMP biological process
GO:0006949 syncytium formation
IEA biological process
GO:0006974 cellular response to DNA
damage stimulus
IEA biological process
GO:0006974 cellular response to DNA
damage stimulus
IEA biological process
GO:0006979 response to oxidative str
ess
IMP biological process
GO:0006979 response to oxidative str
ess
IMP biological process
GO:0007281 germ cell development
IEA biological process
GO:0007283 spermatogenesis
IEA biological process
GO:0007584 response to nutrient
IEA biological process
GO:0008022 protein C-terminus bindin
g
IPI molecular function
GO:0008283 cell proliferation
IEA biological process
GO:0008584 male gonad development
IEA biological process
GO:0009650 UV protection
IEA biological process
GO:0009744 response to sucrose
IEA biological process
GO:0010165 response to X-ray
IEA biological process
GO:0010259 multicellular organism ag
ing
IEA biological process
GO:0016787 hydrolase activity
IEA molecular function
GO:0019904 protein domain specific b
inding
IPI molecular function
GO:0032205 negative regulation of te
lomere maintenance
IMP biological process
GO:0033683 nucleotide-excision repai
r, DNA incision
TAS biological process
GO:0035166 post-embryonic hemopoiesi
s
IEA biological process
GO:0035264 multicellular organism gr
owth
IEA biological process
GO:0036297 interstrand cross-link re
pair
IEA biological process
GO:0036297 interstrand cross-link re
pair
TAS biological process
GO:0045190 isotype switching
IEA biological process
GO:0048468 cell development
IEA biological process
GO:0048477 oogenesis
IEA biological process
GO:0048568 embryonic organ developme
nt
IEA biological process
GO:0051276 chromosome organization
IEA biological process
GO:0070522 ERCC4-ERCC1 complex
IDA cellular component
GO:0070911 global genome nucleotide-
excision repair
TAS biological process
GO:0090656 t-circle formation
IEA biological process
GO:0090656 t-circle formation
ISS biological process
GO:1904431 positive regulation of t-
circle formation
IEA biological process
GO:1904431 positive regulation of t-
circle formation
ISS biological process
GO:0000014 single-stranded DNA endod
eoxyribonuclease activity
IDA molecular function
GO:0043566 structure-specific DNA bi
nding
IDA molecular function
GO:0000109 nucleotide-excision repai
r complex
IDA cellular component
GO:0000109 nucleotide-excision repai
r complex
IDA cellular component
GO:0000109 nucleotide-excision repai
r complex
IDA cellular component
GO:0000110 nucleotide-excision repai
r factor 1 complex
IDA cellular component
GO:0000784 nuclear chromosome, telom
eric region
IDA cellular component
GO:0003684 damaged DNA binding
IDA molecular function
GO:0003697 single-stranded DNA bindi
ng
IDA molecular function
GO:0003697 single-stranded DNA bindi
ng
IDA molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005654 nucleoplasm
IDA cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005737 cytoplasm
IDA cellular component
GO:0006281 DNA repair
IMP biological process
GO:0006283 transcription-coupled nuc
leotide-excision repair
TAS biological process
GO:0006289 nucleotide-excision repai
r
IGI biological process
GO:0006289 nucleotide-excision repai
r
IDA biological process
GO:0006293 nucleotide-excision repai
r, preincision complex st
abilization
TAS biological process
GO:0006295 nucleotide-excision repai
r, DNA incision, 3'-to le
sion
IMP biological process
GO:0006295 nucleotide-excision repai
r, DNA incision, 3'-to le
sion
TAS biological process
GO:0006296 nucleotide-excision repai
r, DNA incision, 5'-to le
sion
IMP biological process
GO:0006296 nucleotide-excision repai
r, DNA incision, 5'-to le
sion
TAS biological process
GO:0006310 DNA recombination
IGI biological process
GO:0006312 mitotic recombination
IMP biological process
GO:0006979 response to oxidative str
ess
IMP biological process
GO:0006979 response to oxidative str
ess
IMP biological process
GO:0008022 protein C-terminus bindin
g
IPI molecular function
GO:0019904 protein domain specific b
inding
IPI molecular function
GO:0032205 negative regulation of te
lomere maintenance
IMP biological process
GO:0033683 nucleotide-excision repai
r, DNA incision
TAS biological process
GO:0036297 interstrand cross-link re
pair
TAS biological process
GO:0070522 ERCC4-ERCC1 complex
IDA cellular component
GO:0070911 global genome nucleotide-
excision repair
TAS biological process
GO:0090656 t-circle formation
ISS biological process
GO:1904431 positive regulation of t-
circle formation
ISS biological process
GO:0000014 single-stranded DNA endod
eoxyribonuclease activity
IDA molecular function
GO:0043566 structure-specific DNA bi
nding
IDA molecular function

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa04064NF-kappa B signaling pathway
hsa01524Platinum drug resistance
Associated diseases References
Cancer (Adenocarcinoma) GAD: 19332728
Cancer (Biliary tract neoplasms) GAD: 19443413
Cancer (colorectal) GAD: 12865926
Cancer (endometrial) GAD: 16284373
Cancer (epithelial ovarian) GAD: 19064572
Cancer (esophageal) GAD: 19339270
Cancer (gastric) GAD: 19822419
Cancer (glioma) GAD: 16212814
Cancer (head and neck) GAD: 20429839
Cancer (kidney) GAD: 16510122
Cancer (laryngeal) GAD: 19444904
Cancer (nasopharyngeal) GAD: 18615480
Cancer (non-melanoma skin cancer) GAD: 15936590
Cancer (oral) GAD: 16393248
Cancer (ovarian) GAD: 16819291
Cancer (prostate) GAD: 18026184
Cancer (rectal) GAD: 20504250
Cancer (Squamous cell) GAD: 20128036
Cancer (stomach) GAD: 17617021
Cancer (testicular) GAD: 15885892
Cancer GAD: 20047592
Cancer (bladder) GAD: 16537713
Cancer (brain) GAD: 19124499
Cancer (leukemia) GAD: 16314400
Cancer (lung) GAD: 12234692
Cancer (lymphoma) GAD: 18830263
Cancer (melanoma) GAD: 15709194
Cancer (myeloma) GAD: 17131345
Cancer (breast) GAD: 15958648
Neutropenia GAD: 19074750
Hodgkin disease GAD: 19573080
Multiple sclerosis GAD: 20522537
Bone diseases GAD: 19434073
Peripheral nervous system diseases GAD: 20979931
Chronic renal failure GAD: 21085059
Male factor infertility MIK: 18616887
Azoospermia MIK: 18616887
Azoospermia GAD: 18616887
Chronic obstructive pulmonary disease (COPD) GAD: 19625176
Cerebrooculo facioskeletal syndrome OMIM: 126380
Disorders of nucleotide excision repair KEGG: H00403
Cryptorchidism MIK: 28606200
Idiopathic azoospermia MIK: 18616887
Male factor infertility MIK: 29961538

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
18616887 Idiopathic
azoosperm
ia
ERCC1 polymorphisms 3 UTR (C8092A), Asn118Asn (G19007A),�ERCC2�polymorphisms Asp312Asn (G-->A), Lys751Gln (A-->C) Chinese
389 (202 infert
ile patients wi
th idiopathic a
zoospermia, 187
fertile contro
ls)
Male infertilityz ERCC1
ERCC2
Show abstract
29961538 Male facto
r infertil
ity

318 (128 couple
s presenting wi
th OAT (MF) and
118 maternal a
ge-matched cont
rol (no MF) sub
jects undergoin
g infertility t
reatment, 72 su
rplus cryoprese
rved blastocyst
s)
Male infertility RNA-seq
Show abstract
28606200 Cryptorchi
dism

Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
Male infertility MeDIP-Seq
Show abstract