Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 2065
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol ERBB3   Gene   UCSC   Ensembl
Aliases ErbB-3, FERLK, HER3, LCCS2, MDA-BF-1, c-erbB-3, c-erbB3, erbB3-S, p180-ErbB3, p45-sErbB3, p85-sErbB3
Gene name erb-b2 receptor tyrosine kinase 3
Alternate names receptor tyrosine-protein kinase erbB-3, human epidermal growth factor receptor 3, proto-oncogene-like protein c-ErbB-3, tyrosine kinase-type cell surface receptor HER3, v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 3,
Gene location 12q13.2 (56080107: 56103504)     Exons: 28     NC_000012.12
Gene summary(Entrez) This gene encodes a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases. This membrane-bound protein has a neuregulin binding domain but not an active kinase domain. It therefore can bind this ligand but not convey th

Protein Summary
Protein general information P21860  

Name: Receptor tyrosine protein kinase erbB 3 (EC 2.7.10.1) (Proto oncogene like protein c ErbB 3) (Tyrosine kinase type cell surface receptor HER3)

Length: 1342  Mass: 148098

Tissue specificity: Epithelial tissues and brain.

Sequence MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLS
FLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIE
KNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQ
CCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTS
CVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGNLDFLITGLNGDPWHK
IPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGGRSLYNRGFSLLIMKNLNVTSLGFRSLKEIS
AGRIYISANRQLCYHHSLNWTKVLRGPTEERLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSR
GGVCVTHCNFLNGEPREFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPI
YKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLTMALTVIAGLVVIFMMLGGTFLYWRGRRIQNKR
AMRRYLERGESIEPLDPSEKANKVLARIFKETELRKLKVLGSGVFGTVHKGVWIPEGESIKIPVCIKVIEDKSGR
QSFQAVTDHMLAIGSLDHAHIVRLLGLCPGSSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYL
EEHGMVHRNLAARNVLLKSPSQVQVADFGVADLLPPDDKQLLYSEAKTPIKWMALESIHFGKYTHQSDVWSYGVT
VWELMTFGAEPYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKELANEFTRMARDPPRY
LVIKRESGPGIAPGPEPHGLTNKKLEEVELEPELDLDLDLEAEEDNLATTTLGSALSLPVGTLNRPRGSQSLLSP
SSGYMPMNQGNLGESCQESAVSGSSERCPRPVSLHPMPRGCLASESSEGHVTGSEAELQEKVSMCRSRSRSRSPR
PRGDSAYHSQRHSLLTPVTPLSPPGLEEEDVNGYVMPDTHLKGTPSSREGTLSSVGLSSVLGTEEEDEDEEYEYM
NRRRRHSPPHPPRPSSLEELGYEYMDVGSDLSASLGSTQSCPLHPVPIMPTAGTTPDEDYEYMNRQRDGGGPGGD
YAAMGACPASEQGYEEMRAFQGPGHQAPHVHYARLKTLRSLEATDSAFDNPDYWHSRLFPKANAQRT
Structural information
Protein Domains
 (709..96-)
(/note="Protein-kinase)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
Interpro:  IPR006211  IPR006212  IPR032778  IPR009030  IPR011009  
IPR000719  IPR000494  IPR036941  IPR001245  IPR016245  
Prosite:   PS50011
CDD:   cd00064

PDB:  		 1M6B 2L9U 3KEX 3LMG 3P11 4LEO 4P59 4RIW 4RIX 4RIY 5CUS 5O4O 5O7P 6OP9
PDBsum:   1M6B 2L9U 3KEX 3LMG 3P11 4LEO 4P59 4RIW 4RIX 4RIY 5CUS 5O4O 5O7P 6OP9

DIP:  
36441
MINT:  
STRING:   ENSP00000267101
Other Databases GeneCards:  ERBB3  Malacards:  ERBB3

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0043235 receptor complex
 IBA cellular component
GO:0033674 positive regulation of ki
nase activity
 IBA biological process
GO:0008284 positive regulation of ce
ll population proliferati
on
 IBA biological process
GO:0004714 transmembrane receptor pr
otein tyrosine kinase act
ivity
 IBA molecular function
GO:0038132 neuregulin binding
 IBA molecular function
GO:0038131 neuregulin receptor activ
ity
 IBA molecular function
GO:0009925 basal plasma membrane
 IBA cellular component
GO:0007399 nervous system developmen
t
 IBA biological process
GO:0007275 multicellular organism de
velopment
 IBA biological process
GO:0007169 transmembrane receptor pr
otein tyrosine kinase sig
naling pathway
 IBA biological process
GO:0005887 integral component of pla
sma membrane
 IBA cellular component
GO:0038132 neuregulin binding
 IDA molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0004672 protein kinase activity
 IEA molecular function
GO:0005524 ATP binding
 IEA molecular function
GO:0006468 protein phosphorylation
 IEA biological process
GO:0007169 transmembrane receptor pr
otein tyrosine kinase sig
naling pathway
 IEA biological process
GO:0016020 membrane
 IEA cellular component
GO:0016021 integral component of mem
brane
 IEA cellular component
GO:0005576 extracellular region
 IEA cellular component
GO:0016740 transferase activity
 IEA molecular function
GO:0016301 kinase activity
 IEA molecular function
GO:0016020 membrane
 IEA cellular component
GO:0016021 integral component of mem
brane
 IEA cellular component
GO:0005524 ATP binding
 IEA molecular function
GO:0000166 nucleotide binding
 IEA molecular function
GO:0005886 plasma membrane
 IEA cellular component
GO:0016310 phosphorylation
 IEA biological process
GO:0005887 integral component of pla
sma membrane
 TAS cellular component
GO:0043235 receptor complex
 IDA cellular component
GO:0000165 MAPK cascade
 TAS biological process
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0051897 positive regulation of pr
otein kinase B signaling
 TAS biological process
GO:0038128 ERBB2 signaling pathway
 TAS biological process
GO:2000145 regulation of cell motili
ty
 TAS biological process
GO:0042802 identical protein binding
 IPI molecular function
GO:0042802 identical protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0003197 endocardial cushion devel
opment
 IEA biological process
GO:0010628 positive regulation of ge
ne expression
 IEA biological process
GO:0016328 lateral plasma membrane
 IEA cellular component
GO:0007422 peripheral nervous system
development
 IEA biological process
GO:0014037 Schwann cell differentiat
ion
 IEA biological process
GO:0016324 apical plasma membrane
 IEA cellular component
GO:0021545 cranial nerve development
 IEA biological process
GO:0043524 negative regulation of ne
uron apoptotic process
 IEA biological process
GO:0055025 positive regulation of ca
rdiac muscle tissue devel
opment
 IEA biological process
GO:0070886 positive regulation of ca
lcineurin-NFAT signaling
cascade
 IEA biological process
GO:0004713 protein tyrosine kinase a
ctivity
 IDA NOT|molecular function
GO:0030296 protein tyrosine kinase a
ctivator activity
 IDA molecular function
GO:0004888 transmembrane signaling r
eceptor activity
 ISS molecular function
GO:0019838 growth factor binding
 ISS molecular function
GO:0019838 growth factor binding
 IPI molecular function
GO:0046982 protein heterodimerizatio
n activity
 IPI molecular function
GO:0005615 extracellular space
 IDA cellular component
GO:0009968 negative regulation of si
gnal transduction
 IDA biological process
GO:0014065 phosphatidylinositol 3-ki
nase signaling
 IDA biological process
GO:0016323 basolateral plasma membra
ne
 IDA cellular component
GO:0042127 regulation of cell popula
tion proliferation
 IDA biological process
GO:0014068 positive regulation of ph
osphatidylinositol 3-kina
se signaling
 TAS biological process
GO:0042060 wound healing
 NAS biological process
GO:0043235 receptor complex
 ISS cellular component
GO:0051402 neuron apoptotic process
 IMP biological process
GO:0007162 negative regulation of ce
ll adhesion
 IDA biological process
GO:0051048 negative regulation of se
cretion
 IDA biological process
GO:0005886 plasma membrane
 TAS cellular component
GO:0007169 transmembrane receptor pr
otein tyrosine kinase sig
naling pathway
 ISS biological process
GO:0007422 peripheral nervous system
development
 ISS biological process
GO:0007507 heart development
 ISS biological process
GO:0014037 Schwann cell differentiat
ion
 ISS biological process
GO:0021545 cranial nerve development
 ISS biological process
GO:0043524 negative regulation of ne
uron apoptotic process
 ISS biological process
GO:0061098 positive regulation of pr
otein tyrosine kinase act
ivity
 IMP biological process
GO:0097192 extrinsic apoptotic signa
ling pathway in absence o
f ligand
 IMP biological process
GO:0005886 plasma membrane
 IEA cellular component
GO:0005576 extracellular region
 IEA cellular component
GO:0018108 peptidyl-tyrosine phospho
rylation
 IEA biological process
GO:0018108 peptidyl-tyrosine phospho
rylation
 IEA biological process
GO:0031625 ubiquitin protein ligase
binding
 IPI molecular function
GO:0038143 ERBB3:ERBB2 complex
 IDA cellular component
GO:0007165 signal transduction
 IDA biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0043125 ErbB-3 class receptor bin
ding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa04151PI3K-Akt signaling pathway
hsa04010MAPK signaling pathway
hsa05206MicroRNAs in cancer
hsa04020Calcium signaling pathway
hsa05205Proteoglycans in cancer
hsa04012ErbB signaling pathway
hsa01521EGFR tyrosine kinase inhibitor resistance

Diseases

Expand All | Collapse All
Associated diseases References
Type 1 diabetes mellitus KEGG:H00408
Lethal congenital contractural syndrome KEGG:H00865
Type 1 diabetes mellitus KEGG:H00408
Lethal congenital contractural syndrome KEGG:H00865
Ductal carcinoma in situ PMID:9470844
Prostate cancer PMID:17532856
urinary bladder cancer PMID:16685269
Transitional cell carcinoma PMID:14614020
Transitional cell carcinoma PMID:16469638
Aberrant CpGs in Low Motility Sperm MIK: 21674046

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm
18
 Male infertility GSE26881
 Show abstract