• Gene id: 206358

Gene Summary

• Gene Symbol: SLC36A1   Gene   UCSC   Ensembl
• Aliases: Dct1, LYAAT1, PAT1, TRAMD3
• Gene name: solute carrier family 36 member 1
• Alternate names: proton-coupled amino acid transporter 1, lysosomal amino acid transporter 1, proton/amino acid transporter 1, solute carrier family 36 (proton/amino acid symporter), member 1,
• Gene location: 5q33.1 (140691726: 140673903)     Exons: 13     NC_000005.10
• Gene summary(Entrez): This gene encodes a member of the eukaryote-specific amino acid/auxin permease (AAAP) 1 transporter family. The encoded protein functions as a proton-dependent, small amino acid transporter. This gene is clustered with related family members on chromosome
• OMIM: 606561

Protein Summary

• Protein general information: Q7Z2H8  
  • Name: Proton coupled amino acid transporter 1 (Proton/amino acid transporter 1) (hPAT1) (Solute carrier family 36 member 1)
  • Length: 476  
  • Mass: 53076
• Sequence:

  MSTQRLRNEDYHDYSSTDVSPEESPSEGLNNLSSPGSYQRFGQSNSTTWFQTLIHLLKGNIGTGLLGLPLAVKNA
  GIVMGPISLLIIGIVAVHCMGILVKCAHHFCRRLNKSFVDYGDTVMYGLESSPCSWLRNHAHWGRRVVDFFLIVT
  QLGFCCVYFVFLADNFKQVIEAANGTTNNCHNNETVILTPTMDSRLYMLSFLPFLVLLVFIRNLRALSIFSLLAN
  ITMLVSLVMIYQFIVQRIPDPSHLPLVAPWKTYPLFFGTAIFSFEGIGMVLPLENKMKDPRKFPLILYLGMVIVT
  ILYISLGCLGYLQFGANIQGSITLNLPNCWLYQSVKLLYSIGIFFTYALQFYVPAEIIIPFFVSRAPEHCELVVD
  LFVRTVLVCLTCILAILIPRLDLVISLVGSVSSSALALIIPPLLEVTTFYSEGMSPLTIFKDALISILGFVGFVV
  GTYEALYELIQPSNAPIFINSTCAFI

• Structural information:
  • Interpro: IPR013057  
  • STRING: ENSP00000243389
• Other Databases: GeneCards:  SLC36A1  Malacards:  SLC36A1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003333	amino acid transmembrane transport	IBA	biological process
GO:0005774	vacuolar membrane	IBA	cellular component
GO:0015171	amino acid transmembrane transporter activity	IBA	molecular function
GO:0015180	L-alanine transmembrane transporter activity	IBA	molecular function
GO:0015187	glycine transmembrane transporter activity	IBA	molecular function
GO:0005280	amino acid:proton symporter activity	IBA	molecular function
GO:0015193	L-proline transmembrane transporter activity	IBA	molecular function
GO:0015808	L-alanine transport	IBA	biological process
GO:0015816	glycine transport	IBA	biological process
GO:0035524	proline transmembrane transport	IBA	biological process
GO:1902600	proton transmembrane transport	IBA	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0006865	amino acid transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0015293	symporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006811	ion transport	TAS	biological process
GO:0015171	amino acid transmembrane transporter activity	TAS	molecular function
GO:0006865	amino acid transport	TAS	biological process
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:1902600	proton transmembrane transport	IEA	biological process
GO:0015804	neutral amino acid transport	IEA	biological process
GO:0005764	lysosome	IEA	cellular component
GO:1902600	proton transmembrane transport	IEA	biological process
GO:0015816	glycine transport	IEA	biological process
GO:0015808	L-alanine transport	IEA	biological process
GO:0015193	L-proline transmembrane transporter activity	IEA	molecular function
GO:0005280	amino acid:proton symporter activity	IEA	molecular function
GO:0015175	neutral amino acid transmembrane transporter activity	IEA	molecular function
GO:0015078	proton transmembrane transporter activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0015824	proline transport	IEA	biological process
GO:0015187	glycine transmembrane transporter activity	IEA	molecular function
GO:0015180	L-alanine transmembrane transporter activity	IEA	molecular function
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005765	lysosomal membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04974	Protein digestion and absorption

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881