• Gene id: 205428

Gene Summary

• Gene Symbol: DIPK2A   Gene   UCSC   Ensembl
• Aliases: C3orf58, DIA1, GoPro49, HASF
• Gene name: divergent protein kinase domain 2A
• Alternate names: divergent protein kinase domain 2A, Golgi Protein of 49 kDa, Golgi protein GoPro49, UPF0672 protein C3orf58, deleted in autism 1, deleted in autism protein 1, hypoxia and AKT-induced stem cell factor, hypoxia and Akt induced stem cell factor,
• Gene location: 3q24 (143971797: 143992367)     Exons: 4     NC_000003.12
• OMIM: 600281

Protein Summary

• Protein general information: Q8NDZ4  
  • Name: Divergent protein kinase domain 2A (Deleted in autism protein 1) (Golgi Protein of 49 kDa) (GoPro49) (Hypoxia and AKT induced stem cell factor) (HASF)
  • Length: 430  
  • Mass: 49482
• Sequence:

  MWRLVPPKLGRLSRSLKLAALGSLLVLMVLHSPSLLASWQRNELTDRRFLQLNKCPACFGTSWCRRFLNGQVVFE
  AWGRLRLLDFLNVKNVYFAQYGEPREGGRRRVVLKRLGSQRELAQLDQSICKRATGRPRCDLLQAMPRTEFARLN
  GDVRLLTPEAVEGWSDLVHCPSQRLLDRLVRRYAETKDSGSFLLRNLKDSERMQLLLTLAFNPEPLVLQSFPSDE
  GWPFAKYLGACGRMVAVNYVGEELWSYFNAPWEKRVDLAWQLMEIAEQLTNNDFEFALYLLDVSFDNFAVGPRDG
  KVIIVDAENVLVADKRLIRQNKPENWDVWYESKFDDCDKEACLSFSKEILCARATVDHNYYAVCQNLLSRHATWR
  GTSGGLLHDPPSEIAKDGRLEALLDECANPKKRYGRFQAAKELREYLAQLSNNVR

• Structural information:
  • Interpro: IPR020519  IPR022049  
  • STRING: ENSP00000320081
• Other Databases: GeneCards:  DIPK2A  Malacards:  DIPK2A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0014066	regulation of phosphatidylinositol 3-kinase signaling	IBA	biological process
GO:0030126	COPI vesicle coat	IBA	cellular component
GO:0060038	cardiac muscle cell proliferation	IBA	biological process
GO:0014066	regulation of phosphatidylinositol 3-kinase signaling	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0060038	cardiac muscle cell proliferation	IDA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0000139	Golgi membrane	IDA	cellular component
GO:0030126	COPI vesicle coat	IDA	cellular component
GO:0034392	negative regulation of smooth muscle cell apoptotic process	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0030137	COPI-coated vesicle	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0030137	COPI-coated vesicle	IEA	cellular component
GO:1900020	positive regulation of protein kinase C activity	IGI	biological process
GO:0034392	negative regulation of smooth muscle cell apoptotic process	IDA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray