• Gene id: 2049

Gene Summary

• Gene Symbol: EPHB3   Gene   UCSC   Ensembl
• Aliases: EK2, ETK2, HEK2, TYRO6
• Gene name: EPH receptor B3
• Alternate names: ephrin type-B receptor 3, EPH-like tyrosine kinase 2, embryonic kinase 2, human embryo kinase 2, tyrosine-protein kinase TYRO6,
• Gene location: 3q27.1 (184561784: 184582407)     Exons: 16     NC_000003.12
• Gene summary(Entrez): Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to
• OMIM: 600011

Protein Summary

• Protein general information: P54753  
  • Name: Ephrin type B receptor 3 (EC 2.7.10.1) (EPH like tyrosine kinase 2) (EPH like kinase 2) (Embryonic kinase 2) (EK2) (hEK2) (Tyrosine protein kinase TYRO6)
  • Length: 998  
  • Mass: 110330
  • Tissue specificity: Ubiquitous.
• Sequence:

  MARARPPPPPSPPPGLLPLLPPLLLLPLLLLPAGCRALEETLMDTKWVTSELAWTSHPESGWEEVSGYDEAMNPI
  RTYQVCNVRESSQNNWLRTGFIWRRDVQRVYVELKFTVRDCNSIPNIPGSCKETFNLFYYEADSDVASASSPFWM
  ENPYVKVDTIAPDESFSRLDAGRVNTKVRSFGPLSKAGFYLAFQDQGACMSLISVRAFYKKCASTTAGFALFPET
  LTGAEPTSLVIAPGTCIPNAVEVSVPLKLYCNGDGEWMVPVGACTCATGHEPAAKESQCRPCPPGSYKAKQGEGP
  CLPCPPNSRTTSPAASICTCHNNFYRADSDSADSACTTVPSPPRGVISNVNETSLILEWSEPRDLGGRDDLLYNV
  ICKKCHGAGGASACSRCDDNVEFVPRQLGLTERRVHISHLLAHTRYTFEVQAVNGVSGKSPLPPRYAAVNITTNQ
  AAPSEVPTLRLHSSSGSSLTLSWAPPERPNGVILDYEMKYFEKSEGIASTVTSQMNSVQLDGLRPDARYVVQVRA
  RTVAGYGQYSRPAEFETTSERGSGAQQLQEQLPLIVGSATAGLVFVVAVVVIAIVCLRKQRHGSDSEYTEKLQQY
  IAPGMKVYIDPFTYEDPNEAVREFAKEIDVSCVKIEEVIGAGEFGEVCRGRLKQPGRREVFVAIKTLKVGYTERQ
  RRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMILTEFMENCALDSFLRLNDGQFTVIQLVGMLRGIAAGMKYLS
  EMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDPSDPTYTSSLGGKIPIRWTAPEAIAYRKFTSASDVWSYG
  IVMWEVMSYGERPYWDMSNQDVINAVEQDYRLPPPMDCPTALHQLMLDCWVRDRNLRPKFSQIVNTLDKLIRNAA
  SLKVIASAQSGMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQMTAEDLLRIGVTLAGH
  QKKILSSIQDMRLQMNQTLPVQV

• Structural information:
  • Protein Domains: (39..21-)
    (/note="Eph-LBD)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00883-)
    (339..45-)
    1 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316-)
    (452..54-)
    2 (/note="Fibronectin-type-III)
    (/evidence="ECO:000-)
  • Interpro: IPR027936  IPR034245  IPR001090  IPR003961  IPR036116   IPR008979  IPR013783  IPR011009  IPR000719  IPR017441  IPR001660  IPR013761  IPR001245  IPR011641  IPR008266  IPR020635  IPR016257  IPR001426  
  • Prosite: PS51550 PS50853 PS00107 PS50011 PS00109 PS00790 PS00791 PS50105
  • CDD: cd10478 cd00063
  • PDB: 3P1I 3ZFY 5L6O 5L6P
  • PDBsum: 3P1I 3ZFY 5L6O 5L6P
  • STRING: ENSP00000332118
• Other Databases: GeneCards:  EPHB3  Malacards:  EPHB3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IBA	molecular function
GO:0033674	positive regulation of kinase activity	IBA	biological process
GO:0043235	receptor complex	IBA	cellular component
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IBA	biological process
GO:0007275	multicellular organism development	IBA	biological process
GO:0048013	ephrin receptor signaling pathway	IDA	biological process
GO:0048013	ephrin receptor signaling pathway	IDA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0022407	regulation of cell-cell adhesion	IDA	biological process
GO:0016477	cell migration	IDA	biological process
GO:0005003	ephrin receptor activity	IDA	molecular function
GO:0005003	ephrin receptor activity	IDA	molecular function
GO:0034446	substrate adhesion-dependent cell spreading	IDA	biological process
GO:0043087	regulation of GTPase activity	IDA	biological process
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0060996	dendritic spine development	ISS	biological process
GO:0050770	regulation of axonogenesis	ISS	biological process
GO:0048538	thymus development	ISS	biological process
GO:0001655	urogenital system development	ISS	biological process
GO:0001525	angiogenesis	ISS	biological process
GO:0060997	dendritic spine morphogenesis	ISS	biological process
GO:0060021	roof of mouth development	ISS	biological process
GO:0051965	positive regulation of synapse assembly	ISS	biological process
GO:0048546	digestive tract morphogenesis	ISS	biological process
GO:0022038	corpus callosum development	ISS	biological process
GO:0007413	axonal fasciculation	ISS	biological process
GO:0007411	axon guidance	ISS	biological process
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0005003	ephrin receptor activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016301	kinase activity	IEA	molecular function
GO:0001525	angiogenesis	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0048013	ephrin receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060996	dendritic spine development	IEA	biological process
GO:0050770	regulation of axonogenesis	IEA	biological process
GO:0048538	thymus development	IEA	biological process
GO:0031290	retinal ganglion cell axon guidance	IEA	biological process
GO:0016477	cell migration	IEA	biological process
GO:0001655	urogenital system development	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0060997	dendritic spine morphogenesis	IEA	biological process
GO:0060021	roof of mouth development	IEA	biological process
GO:0051965	positive regulation of synapse assembly	IEA	biological process
GO:0048546	digestive tract morphogenesis	IEA	biological process
GO:0022038	corpus callosum development	IEA	biological process
GO:0021952	central nervous system projection neuron axonogenesis	IEA	biological process
GO:0008046	axon guidance receptor activity	IEA	molecular function
GO:0007413	axonal fasciculation	IEA	biological process
GO:0007411	axon guidance	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04360	Axon guidance

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq