• Gene id: 2048

Gene Summary

• Gene Symbol: EPHB2   Gene   UCSC   Ensembl
• Aliases: BDPLT22, CAPB, DRT, EK5, EPHT3, ERK, Hek5, PCBC, Tyro5
• Gene name: EPH receptor B2
• Alternate names: ephrin type-B receptor 2, EPH-like kinase 5, developmentally-regulated Eph-related tyrosine kinase, elk-related tyrosine kinase, eph tyrosine kinase 3, protein-tyrosine kinase HEK5, renal carcinoma antigen NY-REN-47, tyrosine-protein kinase TYRO5, tyrosine-protei,
• Gene location: 1p36.12 (113759887: 113696830)     Exons: 22     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the Eph receptor family of receptor tyrosine kinase transmembrane glycoproteins. These receptors are composed of an N-terminal glycosylated ligand-binding domain, a transmembrane region and an intracellular kinase domain. The
• OMIM: 600997

Protein Summary

• Protein general information: P29323  
  • Name: Ephrin type B receptor 2 (EC 2.7.10.1) (Developmentally regulated Eph related tyrosine kinase) (ELK related tyrosine kinase) (EPH tyrosine kinase 3) (EPH like kinase 5) (EK5) (hEK5) (Renal carcinoma antigen NY REN 47) (Tyrosine protein kinase TYRO5) (Tyro
  • Length: 1055  
  • Mass: 117493
  • Tissue specificity: Brain, heart, lung, kidney, placenta, pancreas, liver and skeletal muscle. Preferentially expressed in fetal brain.
• Sequence:

  MALRRLGAALLLLPLLAAVEETLMDSTTATAELGWMVHPPSGWEEVSGYDENMNTIRTYQVCNVFESSQNNWLRT
  KFIRRRGAHRIHVEMKFSVRDCSSIPSVPGSCKETFNLYYYEADFDSATKTFPNWMENPWVKVDTIAADESFSQV
  DLGGRVMKINTEVRSFGPVSRSGFYLAFQDYGGCMSLIAVRVFYRKCPRIIQNGAIFQETLSGAESTSLVAARGS
  CIANAEEVDVPIKLYCNGDGEWLVPIGRCMCKAGFEAVENGTVCRGCPSGTFKANQGDEACTHCPINSRTTSEGA
  TNCVCRNGYYRADLDPLDMPCTTIPSAPQAVISSVNETSLMLEWTPPRDSGGREDLVYNIICKSCGSGRGACTRC
  GDNVQYAPRQLGLTEPRIYISDLLAHTQYTFEIQAVNGVTDQSPFSPQFASVNITTNQAAPSAVSIMHQVSRTVD
  SITLSWSQPDQPNGVILDYELQYYEKELSEYNATAIKSPTNTVTVQGLKAGAIYVFQVRARTVAGYGRYSGKMYF
  QTMTEAEYQTSIQEKLPLIIGSSAAGLVFLIAVVVIAIVCNRRGFERADSEYTDKLQHYTSGHMTPGMKIYIDPF
  TYEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMG
  QFDHPNVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRDLAAR
  NILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGER
  PYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSGI
  NLPLLDRTIPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMR
  AQMNQIQSVEGQPLARRPRATGRTKRCQPRDVTKKTCNSNDGKKKGMGKKKTDPGRGREIQGIFFKEDSHKESND
  CSCGG

• Structural information:
  • Protein Domains: (20..20-)
    (/note="Eph-LBD)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00883-)
    (324..43-)
    1 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316-)
    (435..53-)
    2 (/note="Fibronectin-type-III)
    (/evidence="ECO:000-)
  • Interpro: IPR027936  IPR034238  IPR001090  IPR003961  IPR036116   IPR008979  IPR009030  IPR013783  IPR011009  IPR000719  IPR017441  IPR001660  IPR013761  IPR001245  IPR011641  IPR008266  IPR020635  IPR016257  IPR001426  
  • Prosite: PS51550 PS50853 PS00107 PS50011 PS00109 PS00790 PS00791 PS50105
  • CDD: cd10477 cd00063
  • PDB: 1B4F 1F0M 2QBX 3ZFM
  • PDBsum: 1B4F 1F0M 2QBX 3ZFM
  • DIP: 1162
  • STRING: ENSP00000363763
• Other Databases: GeneCards:  EPHB2  Malacards:  EPHB2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001540	amyloid-beta binding	ISS	molecular function
GO:0004713	protein tyrosine kinase activity	ISS	molecular function
GO:0001540	amyloid-beta binding	TAS	molecular function
GO:0044877	protein-containing complex binding	ISS	molecular function
GO:0007611	learning or memory	ISS	biological process
GO:0007612	learning	ISS	biological process
GO:1904782	negative regulation of NMDA glutamate receptor activity	ISS	biological process
GO:1903078	positive regulation of protein localization to plasma membrane	ISS	biological process
GO:1904783	positive regulation of NMDA glutamate receptor activity	ISS	biological process
GO:1900273	positive regulation of long-term synaptic potentiation	ISS	biological process
GO:0098794	postsynapse	TAS	cellular component
GO:0010628	positive regulation of gene expression	ISS	biological process
GO:0070373	negative regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	ISS	biological process
GO:0001933	negative regulation of protein phosphorylation	ISS	biological process
GO:0048168	regulation of neuronal synaptic plasticity	ISS	biological process
GO:0051389	inactivation of MAPKK activity	ISS	biological process
GO:0031915	positive regulation of synaptic plasticity	ISS	biological process
GO:0046580	negative regulation of Ras protein signal transduction	ISS	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IBA	biological process
GO:0007275	multicellular organism development	IBA	biological process
GO:0021952	central nervous system projection neuron axonogenesis	IBA	biological process
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IBA	molecular function
GO:0033674	positive regulation of kinase activity	IBA	biological process
GO:0043235	receptor complex	IBA	cellular component
GO:0071679	commissural neuron axon guidance	ISS	biological process
GO:0060996	dendritic spine development	ISS	biological process
GO:0050878	regulation of body fluid levels	ISS	biological process
GO:0048013	ephrin receptor signaling pathway	ISS	biological process
GO:0042472	inner ear morphogenesis	ISS	biological process
GO:0030425	dendrite	ISS	cellular component
GO:0030424	axon	ISS	cellular component
GO:0018108	peptidyl-tyrosine phosphorylation	ISS	biological process
GO:0001655	urogenital system development	ISS	biological process
GO:0001525	angiogenesis	ISS	biological process
GO:0060997	dendritic spine morphogenesis	ISS	biological process
GO:0060021	roof of mouth development	ISS	biological process
GO:0051965	positive regulation of synapse assembly	ISS	biological process
GO:0022038	corpus callosum development	ISS	biological process
GO:0007413	axonal fasciculation	ISS	biological process
GO:0007411	axon guidance	ISS	biological process
GO:0005887	integral component of plasma membrane	ISS	cellular component
GO:0005005	transmembrane-ephrin receptor activity	ISS	molecular function
GO:0030193	regulation of blood coagulation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0005003	ephrin receptor activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0007399	nervous system development	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0048013	ephrin receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0099055	integral component of postsynaptic membrane	IEA	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0071679	commissural neuron axon guidance	IEA	biological process
GO:0060996	dendritic spine development	IEA	biological process
GO:0051963	regulation of synapse assembly	IEA	biological process
GO:0051389	inactivation of MAPKK activity	IEA	biological process
GO:0050878	regulation of body fluid levels	IEA	biological process
GO:0050771	negative regulation of axonogenesis	IEA	biological process
GO:0050770	regulation of axonogenesis	IEA	biological process
GO:0048170	positive regulation of long-term neuronal synaptic plasticity	IEA	biological process
GO:0048168	regulation of neuronal synaptic plasticity	IEA	biological process
GO:0048013	ephrin receptor signaling pathway	IEA	biological process
GO:0042472	inner ear morphogenesis	IEA	biological process
GO:0038023	signaling receptor activity	IEA	molecular function
GO:0031915	positive regulation of synaptic plasticity	IEA	biological process
GO:0031290	retinal ganglion cell axon guidance	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0009887	animal organ morphogenesis	IEA	biological process
GO:0007611	learning or memory	IEA	biological process
GO:0005003	ephrin receptor activity	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0001933	negative regulation of protein phosphorylation	IEA	biological process
GO:0001655	urogenital system development	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0000902	cell morphogenesis	IEA	biological process
GO:1903078	positive regulation of protein localization to plasma membrane	IEA	biological process
GO:0097104	postsynaptic membrane assembly	IEA	biological process
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:1904783	positive regulation of NMDA glutamate receptor activity	IEA	biological process
GO:1904782	negative regulation of NMDA glutamate receptor activity	IEA	biological process
GO:1900273	positive regulation of long-term synaptic potentiation	IEA	biological process
GO:0106028	neuron projection retraction	IEA	biological process
GO:0099557	trans-synaptic signaling by trans-synaptic complex, modulating synaptic transmission	IEA	biological process
GO:0099056	integral component of presynaptic membrane	IEA	cellular component
GO:0070373	negative regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0060997	dendritic spine morphogenesis	IEA	biological process
GO:0060021	roof of mouth development	IEA	biological process
GO:0051965	positive regulation of synapse assembly	IEA	biological process
GO:0048593	camera-type eye morphogenesis	IEA	biological process
GO:0046580	negative regulation of Ras protein signal transduction	IEA	biological process
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0043025	neuronal cell body	IEA	cellular component
GO:0042802	identical protein binding	IEA	molecular function
GO:0022038	corpus callosum development	IEA	biological process
GO:0021952	central nervous system projection neuron axonogenesis	IEA	biological process
GO:0021631	optic nerve morphogenesis	IEA	biological process
GO:0016310	phosphorylation	IEA	biological process
GO:0008046	axon guidance receptor activity	IEA	molecular function
GO:0007612	learning	IEA	biological process
GO:0007413	axonal fasciculation	IEA	biological process
GO:0007411	axon guidance	IEA	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0005005	transmembrane-ephrin receptor activity	IEA	molecular function
GO:0001540	amyloid-beta binding	IEA	molecular function
GO:0030425	dendrite	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005005	transmembrane-ephrin receptor activity	TAS	molecular function
GO:0004713	protein tyrosine kinase activity	ISS	molecular function
GO:0016310	phosphorylation	ISS	biological process
GO:0007399	nervous system development	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04360	Axon guidance

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq