• Gene id: 2045

Gene Summary

• Gene Symbol: EPHA7   Gene   UCSC   Ensembl
• Aliases: EHK-3, EHK3, EK11, HEK11
• Gene name: EPH receptor A7
• Alternate names: ephrin type-A receptor 7, EPH homology kinase 3, EPH-like kinase 11, Eph homology kinase-3, receptor protein-tyrosine kinase HEK11, tyrosine-protein kinase receptor EHK-3,
• Gene location: 6q16.1 (93419583: 93240019)     Exons: 21     NC_000006.12
• Gene summary(Entrez): This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically ha
• OMIM: 604046

Protein Summary

• Protein general information: Q15375  
  • Name: Ephrin type A receptor 7 (EC 2.7.10.1) (EPH homology kinase 3) (EHK 3) (EPH like kinase 11) (EK11) (hEK11)
  • Length: 998  
  • Mass: 112097
  • Tissue specificity: Widely expressed.
• Sequence:

  MVFQTRYPSWIILCYIWLLRFAHTGEAQAAKEVLLLDSKAQQTELEWISSPPNGWEEISGLDENYTPIRTYQVCQ
  VMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNIRENLYVKIDTIA
  ADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIIENLAIFPDTVTGSEFS
  SLVEVRGTCVSSAEEEAENAPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGRGFYKSSSQDLQCSRCPTHS
  FSDKEGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADNGGRNDVTYRILCKRCSWE
  QGECVPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEAVNGVSDLSRSQRLFAAVSITTGQAAPSQVSGVM
  KERVLQRSVELSWQEPEHPNGVITEYEIKYYEKDQRERTYSTVKTKSTSASINNLKPGTVYVFQIRAFTAAGYGN
  YSPRLDVATLEEATGKMFEATAVSSEQNPVIIIAVVAVAGTIILVFMVFGFIIGRRHCGYSKADQEGDEELYFHF
  KFPGTKTYIDPETYEDPNRAVHQFAKELDASCIKIERVIGAGEFGEVCSGRLKLPGKRDVAVAIKTLKVGYTEKQ
  RRDFLCEASIMGQFDHPNVVHLEGVVTRGKPVMIVIEFMENGALDAFLRKHDGQFTVIQLVGMLRGIAAGMRYLA
  DMGYVHRDLAARNILVNSNLVCKVSDFGLSRVIEDDPEAVYTTTGGKIPVRWTAPEAIQYRKFTSASDVWSYGIV
  MWEVMSYGERPYWDMSNQDVIKAIEEGYRLPAPMDCPAGLHQLMLDCWQKERAERPKFEQIVGILDKMIRNPNSL
  KTPLGTCSRPISPLLDQNTPDFTTFCSVGEWLQAIKMERYKDNFTAAGYNSLESVARMTIEDVMSLGITLVGHQK
  KIMSSIQTMRAQMLHLHGTGIQV

• Structural information:
  • Protein Domains: (32..21-)
    (/note="Eph-LBD)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00883-)
    (331..44-)
    1 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316-)
    (442..53-)
    2 (/note="Fibronectin-type-III)
    (/evidence="ECO:000-)
  • Interpro: IPR027936  IPR034283  IPR001090  IPR003961  IPR036116   IPR008979  IPR009030  IPR013783  IPR011009  IPR000719  IPR017441  IPR001660  IPR013761  IPR001245  IPR011641  IPR008266  IPR020635  IPR016257  IPR001426  
  • Prosite: PS01186 PS51550 PS50853 PS00107 PS50011 PS00109 PS00790 PS00791 PS50105
  • CDD: cd10485 cd00063
  • PDB: 2REI 3DKO 3H8M 3NRU
  • PDBsum: 2REI 3DKO 3H8M 3NRU
  • STRING: ENSP00000358309
• Other Databases: GeneCards:  EPHA7  Malacards:  EPHA7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IBA	molecular function
GO:0033674	positive regulation of kinase activity	IBA	biological process
GO:0043005	neuron projection	IBA	cellular component
GO:0043235	receptor complex	IBA	cellular component
GO:0005005	transmembrane-ephrin receptor activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IBA	biological process
GO:0007275	multicellular organism development	IBA	biological process
GO:0007411	axon guidance	IBA	biological process
GO:0070372	regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0048013	ephrin receptor signaling pathway	IDA	biological process
GO:0050730	regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0045499	chemorepellent activity	ISS	molecular function
GO:0031952	regulation of protein autophosphorylation	ISS	biological process
GO:0022407	regulation of cell-cell adhesion	ISS	biological process
GO:0005004	GPI-linked ephrin receptor activity	ISS	molecular function
GO:0050919	negative chemotaxis	ISS	biological process
GO:0048755	branching morphogenesis of a nerve	ISS	biological process
GO:0043525	positive regulation of neuron apoptotic process	ISS	biological process
GO:0043281	regulation of cysteine-type endopeptidase activity involved in apoptotic process	ISS	biological process
GO:0008046	axon guidance receptor activity	ISS	molecular function
GO:0007420	brain development	ISS	biological process
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0005003	ephrin receptor activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0007399	nervous system development	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0048013	ephrin receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0099175	regulation of postsynapse organization	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0072178	nephric duct morphogenesis	IEA	biological process
GO:0051964	negative regulation of synapse assembly	IEA	biological process
GO:0048671	negative regulation of collateral sprouting	IEA	biological process
GO:0048013	ephrin receptor signaling pathway	IEA	biological process
GO:0045499	chemorepellent activity	IEA	molecular function
GO:0031952	regulation of protein autophosphorylation	IEA	biological process
GO:0031290	retinal ganglion cell axon guidance	IEA	biological process
GO:0022407	regulation of cell-cell adhesion	IEA	biological process
GO:0005004	GPI-linked ephrin receptor activity	IEA	molecular function
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0098685	Schaffer collateral - CA1 synapse	IEA	cellular component
GO:0046875	ephrin receptor binding	IEA	molecular function
GO:0030425	dendrite	IEA	cellular component
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0050730	regulation of peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0048755	branching morphogenesis of a nerve	IEA	biological process
GO:0043525	positive regulation of neuron apoptotic process	IEA	biological process
GO:0043281	regulation of cysteine-type endopeptidase activity involved in apoptotic process	IEA	biological process
GO:0008046	axon guidance receptor activity	IEA	molecular function
GO:0007420	brain development	IEA	biological process
GO:0001934	positive regulation of protein phosphorylation	IEA	biological process
GO:0099061	integral component of postsynaptic density membrane	IEA	cellular component
GO:0099060	integral component of postsynaptic specialization membrane	IEA	cellular component
GO:0098686	hippocampal mossy fiber to CA3 synapse	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0031594	neuromuscular junction	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0016310	phosphorylation	ISS	biological process
GO:0004713	protein tyrosine kinase activity	ISS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04360	Axon guidance

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq