• Gene id: 2043

Gene Summary

• Gene Symbol: EPHA4   Gene   UCSC   Ensembl
• Aliases: EK8, HEK8, SEK, TYRO1
• Gene name: EPH receptor A4
• Alternate names: ephrin type-A receptor 4, EPH-like kinase 8, TYRO1 protein tyrosine kinase, receptor protein-tyrosine kinase HEK8, tyrosine-protein kinase TYRO1, tyrosine-protein kinase receptor SEK,
• Gene location: 2q36.1 (221574201: 221418026)     Exons: 19     NC_000002.12
• Gene summary(Entrez): This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically ha
• OMIM: 602188

Protein Summary

• Protein general information: P54764  
  • Name: Ephrin type A receptor 4 (EC 2.7.10.1) (EPH like kinase 8) (EK8) (hEK8) (Tyrosine protein kinase TYRO1) (Tyrosine protein kinase receptor SEK)
  • Length: 986  
  • Mass: 109860
  • Tissue specificity: Ubiquitous.
• Sequence:

  MAGIFYFALFSCLFGICDAVTGSRVYPANEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDEKNTPIRTYQVCNV
  MEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDNDKERFIRENQFVKIDTIAA
  DESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKCPLTVRNLAQFPDTITGADTSS
  LVEVRGSCVNNSEEKDVPKMYCGADGEWLVPIGNCLCNAGHEERSGECQACKIGYYKALSTDATCAKCPPHSYSV
  WEGATSCTCDRGFFRADNDAASMPCTRPPSAPLNLISNVNETSVNLEWSSPQNTGGRQDISYNVVCKKCGAGDPS
  KCRPCGSGVHYTPQQNGLKTTKVSITDLLAHTNYTFEIWAVNGVSKYNPNPDQSVSVTVTTNQAAPSSIALVQAK
  EVTRYSVALAWLEPDRPNGVILEYEVKYYEKDQNERSYRIVRTAARNTDIKGLNPLTSYVFHVRARTAAGYGDFS
  EPLEVTTNTVPSRIIGDGANSTVLLVSVSGSVVLVVILIAAFVISRRRSKYSKAKQEADEEKHLNQGVRTYVDPF
  TYEDPNQAVREFAKEIDASCIKIEKVIGVGEFGEVCSGRLKVPGKREICVAIKTLKAGYTDKQRRDFLSEASIMG
  QFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTVIQLVGMLRGIGSGMKYLSDMSYVHRDLAAR
  NILVNSNLVCKVSDFGMSRVLEDDPEAAYTTRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPY
  WDMSNQDVIKAIEEGYRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQIVNMLDKLIRNPNSLKRTGTESSRPNT
  ALLDPSSPEFSAVVSVGDWLQAIKMDRYKDNFTAAGYTTLEAVVHVNQEDLARIGITAITHQNKILSSVQAMRTQ
  MQQMHGRMVPV

• Structural information:
  • Protein Domains: (30..20-)
    (/note="Eph-LBD)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00883-)
    (328..43-)
    1 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316-)
    (440..53-)
    2 (/note="Fibronectin-type-III)
    (/evidence="ECO:000-)
  • Interpro: IPR027936  IPR034270  IPR001090  IPR003961  IPR036116   IPR008979  IPR013783  IPR011009  IPR000719  IPR017441  IPR001660  IPR013761  IPR001245  IPR011641  IPR008266  IPR020635  IPR016257  IPR001426  
  • Prosite: PS51550 PS50853 PS00107 PS50011 PS00109 PS00790 PS00791 PS50105
  • CDD: cd10482 cd00063
  • PDB: 2LW8 2WO1 2WO2 2WO3 3CKH 3GXU 4BK4 4BK5 4BKA 4BKF 4M4P 4M4R 4W4Z 4W50 5JR2
  • PDBsum: 2LW8 2WO1 2WO2 2WO3 3CKH 3GXU 4BK4 4BK5 4BKA 4BKF 4M4P 4M4R 4W4Z 4W50 5JR2
  • DIP: 48294
  • STRING: ENSP00000281821
• Other Databases: GeneCards:  EPHA4  Malacards:  EPHA4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001540	amyloid-beta binding	TAS	molecular function
GO:1990782	protein tyrosine kinase binding	IPI	molecular function
GO:0016301	kinase activity	IGI	molecular function
GO:0106030	neuron projection fasciculation	ISS	biological process
GO:1904646	cellular response to amyloid-beta	ISS	biological process
GO:1902961	positive regulation of aspartic-type endopeptidase activity involved in amyloid precursor protein catabolic process	IGI	biological process
GO:1903051	negative regulation of proteolysis involved in cellular protein catabolic process	IGI	biological process
GO:0097485	neuron projection guidance	ISS	biological process
GO:1902004	positive regulation of amyloid-beta formation	IGI	biological process
GO:1900272	negative regulation of long-term synaptic potentiation	ISS	biological process
GO:1905244	regulation of modification of synaptic structure	ISS	biological process
GO:1905244	regulation of modification of synaptic structure	ISS	biological process
GO:0048013	ephrin receptor signaling pathway	IGI	biological process
GO:0005886	plasma membrane	NAS	cellular component
GO:0050821	protein stabilization	IGI	biological process
GO:0043197	dendritic spine	ISS	cellular component
GO:0043198	dendritic shaft	ISS	cellular component
GO:0010977	negative regulation of neuron projection development	ISS	biological process
GO:0061098	positive regulation of protein tyrosine kinase activity	ISS	biological process
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IBA	molecular function
GO:0033674	positive regulation of kinase activity	IBA	biological process
GO:0043005	neuron projection	IBA	cellular component
GO:0043235	receptor complex	IBA	cellular component
GO:0005005	transmembrane-ephrin receptor activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IBA	biological process
GO:0007275	multicellular organism development	IBA	biological process
GO:0007411	axon guidance	IBA	biological process
GO:0043197	dendritic spine	IBA	cellular component
GO:0097156	fasciculation of motor neuron axon	ISS	biological process
GO:0097155	fasciculation of sensory neuron axon	ISS	biological process
GO:0050770	regulation of axonogenesis	ISS	biological process
GO:0048710	regulation of astrocyte differentiation	ISS	biological process
GO:0048681	negative regulation of axon regeneration	ISS	biological process
GO:0031901	early endosome membrane	ISS	cellular component
GO:0030425	dendrite	ISS	cellular component
GO:0030424	axon	ISS	cellular component
GO:0021957	corticospinal tract morphogenesis	ISS	biological process
GO:0005004	GPI-linked ephrin receptor activity	ISS	molecular function
GO:0061001	regulation of dendritic spine morphogenesis	ISS	biological process
GO:0043087	regulation of GTPase activity	ISS	biological process
GO:0008045	motor neuron axon guidance	ISS	biological process
GO:0005887	integral component of plasma membrane	ISS	cellular component
GO:0005005	transmembrane-ephrin receptor activity	ISS	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0005003	ephrin receptor activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0016301	kinase activity	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0007399	nervous system development	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0016310	phosphorylation	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0048013	ephrin receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0098883	synapse pruning	IEA	biological process
GO:0050775	positive regulation of dendrite morphogenesis	IEA	biological process
GO:0048681	negative regulation of axon regeneration	IEA	biological process
GO:0046875	ephrin receptor binding	IEA	molecular function
GO:0044297	cell body	IEA	cellular component
GO:0044295	axonal growth cone	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0030175	filopodium	IEA	cellular component
GO:0008347	glial cell migration	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:1904646	cellular response to amyloid-beta	IEA	biological process
GO:0106030	neuron projection fasciculation	IEA	biological process
GO:0099055	integral component of postsynaptic membrane	IEA	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0098883	synapse pruning	IEA	biological process
GO:0098685	Schaffer collateral - CA1 synapse	IEA	cellular component
GO:0097156	fasciculation of motor neuron axon	IEA	biological process
GO:0097155	fasciculation of sensory neuron axon	IEA	biological process
GO:0072178	nephric duct morphogenesis	IEA	biological process
GO:0050770	regulation of axonogenesis	IEA	biological process
GO:0048710	regulation of astrocyte differentiation	IEA	biological process
GO:0048681	negative regulation of axon regeneration	IEA	biological process
GO:0034332	adherens junction organization	IEA	biological process
GO:0031901	early endosome membrane	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0021957	corticospinal tract morphogenesis	IEA	biological process
GO:0005004	GPI-linked ephrin receptor activity	IEA	molecular function
GO:1905244	regulation of modification of synaptic structure	IEA	biological process
GO:0043679	axon terminus	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0043198	dendritic shaft	IEA	cellular component
GO:0043197	dendritic spine	IEA	cellular component
GO:0043087	regulation of GTPase activity	IEA	biological process
GO:0031594	neuromuscular junction	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:1905244	regulation of modification of synaptic structure	IEA	biological process
GO:1900272	negative regulation of long-term synaptic potentiation	IEA	biological process
GO:0099056	integral component of presynaptic membrane	IEA	cellular component
GO:0097485	neuron projection guidance	IEA	biological process
GO:0090102	cochlea development	IEA	biological process
GO:0061098	positive regulation of protein tyrosine kinase activity	IEA	biological process
GO:0061001	regulation of dendritic spine morphogenesis	IEA	biological process
GO:0043507	positive regulation of JUN kinase activity	IEA	biological process
GO:0043087	regulation of GTPase activity	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0010977	negative regulation of neuron projection development	IEA	biological process
GO:0008045	motor neuron axon guidance	IEA	biological process
GO:0007628	adult walking behavior	IEA	biological process
GO:0007411	axon guidance	IEA	biological process
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0005005	transmembrane-ephrin receptor activity	IEA	molecular function
GO:0030424	axon	IEA	cellular component
GO:0005912	adherens junction	IEA	cellular component
GO:0098839	postsynaptic density membrane	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:2001108	positive regulation of Rho guanyl-nucleotide exchange factor activity	IDA	biological process
GO:0004672	protein kinase activity	IDA	molecular function
GO:0097161	DH domain binding	IDA	molecular function
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0042731	PH domain binding	IPI	molecular function
GO:0005737	cytoplasm	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04360	Axon guidance

Diseases

Associated diseases	References
Alzheimer's disease	PMID:19542617
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)