• Gene id: 2041

Gene Summary

• Gene Symbol: EPHA1   Gene   UCSC   Ensembl
• Aliases: EPH, EPHT, EPHT1
• Gene name: EPH receptor A1
• Alternate names: ephrin type-A receptor 1, eph tyrosine kinase 1, erythropoietin-producing hepatoma amplified sequence, erythropoietin-producing hepatoma receptor, hEpha1, oncogene EPH, soluble EPHA1 variant 1, soluble EPHA1 variant 2, tyrosine-protein kinase receptor EPH,
• Gene location: 7q34-q35 (143408864: 143390812)     Exons: 18     NC_000007.14
• Gene summary(Entrez): This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically ha

Protein Summary

• Protein general information: P21709  
  • Name: Ephrin type A receptor 1 (hEpha1) (EC 2.7.10.1) (EPH tyrosine kinase) (EPH tyrosine kinase 1) (Erythropoietin producing hepatoma receptor) (Tyrosine protein kinase receptor EPH)
  • Length: 976  
  • Mass: 108127
  • Tissue specificity: Overexpressed in several carcinomas.
• Sequence:

  MERRWPLGLGLVLLLCAPLPPGARAKEVTLMDTSKAQGELGWLLDPPKDGWSEQQQILNGTPLYMYQDCPMQGRR
  DTDHWLRSNWIYRGEEASRVHVELQFTVRDCKSFPGGAGPLGCKETFNLLYMESDQDVGIQLRRPLFQKVTTVAA
  DQSFTIRDLVSGSVKLNVERCSLGRLTRRGLYLAFHNPGACVALVSVRVFYQRCPETLNGLAQFPDTLPGPAGLV
  EVAGTCLPHARASPRPSGAPRMHCSPDGEWLVPVGRCHCEPGYEEGGSGEACVACPSGSYRMDMDTPHCLTCPQQ
  STAESEGATICTCESGHYRAPGEGPQVACTGPPSAPRNLSFSASGTQLSLRWEPPADTGGRQDVRYSVRCSQCQG
  TAQDGGPCQPCGVGVHFSPGARGLTTPAVHVNGLEPYANYTFNVEAQNGVSGLGSSGHASTSVSISMGHAESLSG
  LSLRLVKKEPRQLELTWAGSRPRSPGANLTYELHVLNQDEERYQMVLEPRVLLTELQPDTTYIVRVRMLTPLGPG
  PFSPDHEFRTSPPVSRGLTGGEIVAVIFGLLLGAALLLGILVFRSRRAQRQRQQRQRDRATDVDREDKLWLKPYV
  DLQAYEDPAQGALDFTRELDPAWLMVDTVIGEGEFGEVYRGTLRLPSQDCKTVAIKTLKDTSPGGQWWNFLREAT
  IMGQFSHPHILHLEGVVTKRKPIMIITEFMENGALDAFLREREDQLVPGQLVAMLQGIASGMNYLSNHNYVHRDL
  AARNILVNQNLCCKVSDFGLTRLLDDFDGTYETQGGKIPIRWTAPEAIAHRIFTTASDVWSFGIVMWEVLSFGDK
  PYGEMSNQEVMKSIEDGYRLPPPVDCPAPLYELMKNCWAYDRARRPHFQKLQAHLEQLLANPHSLRTIANFDPRM
  TLRLPSLSGSDGIPYRTVSEWLESIRMKRYILHFHSAGLDTMECVLELTAEDLTQMGITLPGHQKRILCSIQGFK
  D

• Structural information:
  • Protein Domains: (27..20-)
    (/note="Eph-LBD)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00883-)
    (332..44-)
    1 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316-)
    (447..53-)
    2 (/note="Fibronectin-type-III)
    (/evidence="ECO:000-)
  • Interpro: IPR027936  IPR034251  IPR001090  IPR003961  IPR036116   IPR008979  IPR009030  IPR013783  IPR011009  IPR000719  IPR017441  IPR001660  IPR013761  IPR001245  IPR011641  IPR008266  IPR020635  IPR016257  IPR001426  
  • Prosite: PS01186 PS51550 PS50853 PS00107 PS50011 PS00109 PS00790 PS00791 PS50105
  • CDD: cd10479 cd00063
  • PDB: 2K1K 2K1L 3HIL 3KKA
  • PDBsum: 2K1K 2K1L 3HIL 3KKA
  • DIP: 34886
  • STRING: ENSP00000275815
• Other Databases: GeneCards:  EPHA1  Malacards:  EPHA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005005	transmembrane-ephrin receptor activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IBA	biological process
GO:0007275	multicellular organism development	IBA	biological process
GO:0007411	axon guidance	IBA	biological process
GO:0043197	dendritic spine	IBA	cellular component
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IBA	molecular function
GO:0033674	positive regulation of kinase activity	IBA	biological process
GO:0043005	neuron projection	IBA	cellular component
GO:0043235	receptor complex	IBA	cellular component
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0090630	activation of GTPase activity	IDA	biological process
GO:0030336	negative regulation of cell migration	IDA	biological process
GO:0001954	positive regulation of cell-matrix adhesion	IDA	biological process
GO:0034446	substrate adhesion-dependent cell spreading	IDA	biological process
GO:0043087	regulation of GTPase activity	IDA	biological process
GO:0007166	cell surface receptor signaling pathway	IDA	biological process
GO:0006469	negative regulation of protein kinase activity	IDA	biological process
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0005005	transmembrane-ephrin receptor activity	IDA	molecular function
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0045766	positive regulation of angiogenesis	IMP	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0005003	ephrin receptor activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0001525	angiogenesis	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0007155	cell adhesion	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0035019	somatic stem cell population maintenance	TAS	biological process
GO:0048013	ephrin receptor signaling pathway	TAS	biological process
GO:0051496	positive regulation of stress fiber assembly	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0018108	peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0004672	protein kinase activity	IDA	molecular function
GO:0051496	positive regulation of stress fiber assembly	ISS	biological process
GO:0005005	transmembrane-ephrin receptor activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IBA	biological process
GO:0007275	multicellular organism development	IBA	biological process
GO:0007411	axon guidance	IBA	biological process
GO:0043197	dendritic spine	IBA	cellular component
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IBA	molecular function
GO:0033674	positive regulation of kinase activity	IBA	biological process
GO:0043005	neuron projection	IBA	cellular component
GO:0043235	receptor complex	IBA	cellular component
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0090630	activation of GTPase activity	IDA	biological process
GO:0030336	negative regulation of cell migration	IDA	biological process
GO:0001954	positive regulation of cell-matrix adhesion	IDA	biological process
GO:0034446	substrate adhesion-dependent cell spreading	IDA	biological process
GO:0043087	regulation of GTPase activity	IDA	biological process
GO:0007166	cell surface receptor signaling pathway	IDA	biological process
GO:0006469	negative regulation of protein kinase activity	IDA	biological process
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0005005	transmembrane-ephrin receptor activity	IDA	molecular function
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0045766	positive regulation of angiogenesis	IMP	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0005003	ephrin receptor activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0001525	angiogenesis	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0007155	cell adhesion	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0035019	somatic stem cell population maintenance	TAS	biological process
GO:0048013	ephrin receptor signaling pathway	TAS	biological process
GO:0051496	positive regulation of stress fiber assembly	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0018108	peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0004672	protein kinase activity	IDA	molecular function
GO:0051496	positive regulation of stress fiber assembly	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04360	Axon guidance

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq