• Gene id: 203427

Gene Summary

• Gene Symbol: SLC25A43   Gene   UCSC   Ensembl
• Gene name: solute carrier family 25 member 43
• Alternate names: solute carrier family 25 member 43,
• Gene location: Xq24 (119399325: 119454477)     Exons: 9     NC_000023.11
• Gene summary(Entrez): This gene encodes a member of the mitochondrial carrier family of proteins.[provided by RefSeq, Dec 2009]
• OMIM: 300641

Protein Summary

• Protein general information: Q8WUT9  
  • Name: Solute carrier family 25 member 43
  • Length: 341  
  • Mass: 37718
• Sequence:

  MATWRRDGRLTGGQRLLCAGLAGTLSLSLTAPLELATVLAQVGVVRGHARGPWATGHRVWRAEGLRALWKGNAVA
  CLRLFPCSAVQLAAYRKFVVLFTDDLGHISQWSSIMAGSLAGMVSTIVTYPTDLIKTRLIMQNILEPSYRGLLHA
  FSTIYQQEGFLALYRGVSLTVVGALPFSAGSLLVYMNLEKIWNGPRDQFSLPQNFANVCLAAAVTQTLSFPFETV
  KRKMQAQSPYLPHSGGVDVHFSGAVDCFRQIVKAQGVLGLWNGLTANLLKIVPYFGIMFSTFEFCKRICLYQNGY
  ILSPLSYKLTPGVDQSLQPQELRELKKFFKTRKPKPKKPTL

• Structural information:
  • Interpro: IPR002067  IPR018108  IPR023395  
  • Prosite: PS50920
  • STRING: ENSP00000217909
• Other Databases: GeneCards:  SLC25A43  Malacards:  SLC25A43

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005347	ATP transmembrane transporter activity	IEA	molecular function
GO:0055085	transmembrane transport	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0015867	ATP transport	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881