• Gene id: 203413

Gene Summary

• Gene Symbol: CT83   Gene   UCSC   Ensembl
• Aliases: CXorf61, KK-LC-1, KKLC1
• Gene name: cancer/testis antigen 83
• Alternate names: kita-kyushu lung cancer antigen 1,
• Gene location: Xq23 (116463032: 116461685)     Exons: 2     NC_000023.11
• OMIM: 300625

Protein Summary

• Protein general information: Q5H943  
  • Name: Kita kyushu lung cancer antigen 1 (KK LC 1) (Cancer/testis antigen 83)
  • Length: 113  
  • Mass: 12,784
• Sequence:

  MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIA
  RQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST

• Structural information:
  • Interpro: IPR027940  
  • STRING: ENSP00000360961
• Other Databases: GeneCards:  CT83  Malacards:  CT83

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IDA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component

Diseases

Associated diseases	References
Cancer (prostate)	GAD: 17903305
Male factor infertility	MIK: 22016351
Azoospermia	MIK: 22016351
Oligozoospermia	MIK: 22016351
Azoospermia, Oligozoospermia	MIK: 22016351
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
22016351	Azoospermia, Oligozoospermia	SNPs rs5911500 in LOC203413, rs3088232 in BRDT, and rs11204546 in OR2W3	Macedon ians, A lbanian s	297 (136 men with idiopathic infertility (60 azoospermic and 76 oligozoospermic), 161 fertile controls)	Male infertility	FASLG JMJDIA LOC203413 TEX15 BRDT OR2W3 INSR and TAS2R38
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R