• Gene id: 2033

Gene Summary

• Gene Symbol: EP300   Gene   UCSC   Ensembl
• Aliases: KAT3B, MKHK2, RSTS2, p300
• Gene name: E1A binding protein p300
• Alternate names: histone acetyltransferase p300, E1A-associated protein p300, E1A-binding protein, 300kD, histone butyryltransferase p300, histone crotonyltransferase p300, p300 HAT, protein 2-hydroxyisobutyryltransferase p300, protein propionyltransferase p300,
• Gene location: 22q13.2 (41092591: 41180076)     Exons: 3     NC_000022.11
• Gene summary(Entrez): This gene encodes the adenovirus E1A-associated cellular p300 transcriptional co-activator protein. It functions as histone acetyltransferase that regulates transcription via chromatin remodeling and is important in the processes of cell proliferation and
• OMIM: 602700

Protein Summary

• Protein general information: Q09472  
  • Name: Histone acetyltransferase p300 (p300 HAT) (EC 2.3.1.48) (E1A associated protein p300) (Histone butyryltransferase p300) (EC 2.3.1. ) (Histone crotonyltransferase p300) (EC 2.3.1. ) (Protein 2 hydroxyisobutyryltransferase p300) (EC 2.3.1. ) (Protein propio
  • Length: 2414  
  • Mass: 264161
• Sequence:

  MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGDINQLQTSLGMVQDAA
  SKHKQLSELLRSGSSPNLNMGVGGPGQVMASQAQQSSPGLGLINSMVKSPMTQAGLTSPNMGMGTSGPNQGPTQS
  TGMMNSPVNQPAMGMNTGMNAGMNPGMLAAGNGQGIMPNQVMNGSIGAGRGRQNMQYPNPGMGSAGNLLTEPLQQ
  GSPQMGGQTGLRGPQPLKMGMMNNPNPYGSPYTQNPGQQIGASGLGLQIQTKTVLSNNLSPFAMDKKAVPGGGMP
  NMGQQPAPQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNV
  LNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNAGDKRNQQPILTGAPVGLGNPSSLGVGQQSA
  PNLSTVSQIDPSSIERAYAALGLPYQVNQMPTQPQVQAKNQQNQQPGQSPQGMRPMSNMSASPMGVNGGVGVQTP
  SLLSDSMLHSAINSQNPMMSENASVPSLGPMPTAAQPSTTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAAL
  KDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLPNAAGMVPVSMNPGPNM
  GQPQPGMTSNGPLPDPSMIRGSVPNQMMPRITPQSGLNQFGQMSMAQPPIVPRQTPPLQHHGQLAQPGALNPPMG
  YGPRMQQPSNQGQFLPQTQFPSQGMNVTNIPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQP
  ALHQNSPSPVPSRTPTPHHTPPSIGAQQPPATTIPAPVPTPPAMPPGPQSQALHPPPRQTPTPPTTQLPQQVQPS
  LPAAPSADQPQQQPRSQQSTAASVPTPTAPLLPPQPATPLSQPAVSIEGQVSNPPSTSSTEVNSQAIAEKQPSQE
  VKMEAKMEVDQPEPADTQPEDISESKVEDCKMESTETEERSTELKTEIKEEEDQPSTSATQSSPAPGQSKKKIFK
  PEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMF
  NNAWLYNRKTSRVYKYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHF
  CEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHEIIWPAGFVCDGC
  LKKSARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEVTVRVVHASDKTVEVKPGMKARFVDSGEMA
  ESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYV
  KKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAKE
  LPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPN
  VSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWS
  TMCMLVELHTQSQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQ
  SPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENK
  CPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPTTPTGQQPTTPQTPQPTSQP
  QPTPPNSMPPYLPRTQAAGPVSQGKAAGQVTPPTPPQTAQPPLPGPPPAAVEMAMQIQRAAETQRQMAHVQIFQR
  PIQHQMPPMTPMAPMGMNPPPMTRGPSGHLEPGMGPTGMQQQPPWSQGGLPQPQQLQSGMPRPAMMSVAQHGQPL
  NMAPQPGLGQVGISPLKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNPQPI
  PGQPGMPQGQPGLQPPTMPGQQGVHSNPAMQNMNPMQAGVQRAGLPQQQPQQQLQPPMGGMSPQAQQMNMNHNTM
  PSQFRDILRRQQMMQQQQQQGAGPGIGPGMANHNQFQQPQGVGYPPQQQQRMQHHMQQMQQGNMGQIGQLPQALG
  AEAGASLQAYQQRLLQQQMGSPVQPNPMSPQQHMLPNQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHS
  SPSPRMQPQPSPHHVSPQTSSPHPGLVAAQANPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLSTDNS
  DLNSNLSQSTLDIH

• Structural information:
  • Protein Domains: (566..64-)
    (/note="KIX-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00311-)
    (1067..113-)
    (/note="Bromo-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00035-)
    (1287..166-)
    (/note="CBP/p300-type-HAT)
    (/evidence="ECO:0000255|PROSITE-ProRule:-)
  • Interpro: IPR001487  IPR036427  IPR018359  IPR031162  IPR013178   IPR003101  IPR036529  IPR009110  IPR014744  IPR037073  IPR010303  IPR038547  IPR035898  IPR013083  IPR000197  IPR000433  
  • Prosite: PS00633 PS50014 PS51727 PS50952 PS50134 PS01357 PS50135
  • CDD: cd15802
  • PDB: 1L3E 1P4Q 2K8F 2MH0 2MZD 3BIY 3I3J 3IO2 3P57 3T92 4BHW 4PZR 4PZS 4PZT 5BT3 5KJ2 5LKT 5LKU 5LKX 5LKZ 5LPK 5LPM 5NU5 5XZC 6DS6 6FGN 6FGS 6GYR 6GYT 6K4N 6PF1 6PGU
  • PDBsum: 1L3E 1P4Q 2K8F 2MH0 2MZD 3BIY 3I3J 3IO2 3P57 3T92 4BHW 4PZR 4PZS 4PZT 5BT3 5KJ2 5LKT 5LKU 5LKX 5LKZ 5LPK 5LPM 5NU5 5XZC 6DS6 6FGN 6FGS 6GYR 6GYT 6K4N 6PF1 6PGU
  • DIP: 257
  • STRING: ENSP00000263253
• Other Databases: GeneCards:  EP300  Malacards:  EP300

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1901224	positive regulation of NIK/NF-kappaB signaling	IDA	biological process
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:1905636	positive regulation of RNA polymerase II regulatory region sequence-specific DNA binding	IDA	biological process
GO:0016407	acetyltransferase activity	IDA	molecular function
GO:0001102	RNA polymerase II activating transcription factor binding	IPI	molecular function
GO:0001102	RNA polymerase II activating transcription factor binding	IPI	molecular function
GO:0004402	histone acetyltransferase activity	TAS	molecular function
GO:0003713	transcription coactivator activity	IPI	molecular function
GO:0003713	transcription coactivator activity	IPI	molecular function
GO:0003713	transcription coactivator activity	TAS	molecular function
GO:0048156	tau protein binding	NAS	molecular function
GO:0018394	peptidyl-lysine acetylation	IDA	biological process
GO:0018394	peptidyl-lysine acetylation	IDA	biological process
GO:0010976	positive regulation of neuron projection development	IDA	biological process
GO:0016573	histone acetylation	IDA	biological process
GO:0051059	NF-kappaB binding	IPI	molecular function
GO:0051059	NF-kappaB binding	IPI	molecular function
GO:0031333	negative regulation of protein-containing complex assembly	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0007399	nervous system development	TAS	biological process
GO:0032993	protein-DNA complex	ISS	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	TAS	biological process
GO:0006473	protein acetylation	TAS	biological process
GO:0010506	regulation of autophagy	TAS	biological process
GO:0043969	histone H2B acetylation	IDA	biological process
GO:0043627	response to estrogen	IDA	biological process
GO:0042771	intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IDA	biological process
GO:0018393	internal peptidyl-lysine acetylation	IDA	biological process
GO:0016746	transferase activity, transferring acyl groups	IDA	molecular function
GO:0016407	acetyltransferase activity	IDA	molecular function
GO:0004402	histone acetyltransferase activity	IDA	molecular function
GO:0004402	histone acetyltransferase activity	IDA	molecular function
GO:0001666	response to hypoxia	IDA	biological process
GO:0003682	chromatin binding	IDA	molecular function
GO:0016407	acetyltransferase activity	IDA	molecular function
GO:0006473	protein acetylation	IDA	biological process
GO:0006473	protein acetylation	IDA	biological process
GO:0090043	regulation of tubulin deacetylation	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0006475	internal protein amino acid acetylation	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0004468	lysine N-acetyltransferase activity, acting on acetyl phosphate as donor	IDA	molecular function
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0034644	cellular response to UV	IDA	biological process
GO:0003684	damaged DNA binding	IDA	molecular function
GO:0045815	positive regulation of gene expression, epigenetic	IDA	biological process
GO:0003682	chromatin binding	IDA	molecular function
GO:0004402	histone acetyltransferase activity	IDA	molecular function
GO:0140068	histone crotonyltransferase activity	IDA	molecular function
GO:0061920	protein propionyltransferase activity	IDA	molecular function
GO:0006110	regulation of glycolytic process	IDA	biological process
GO:0010742	macrophage derived foam cell differentiation	IDA	biological process
GO:0051091	positive regulation of DNA-binding transcription factor activity	IDA	biological process
GO:0016573	histone acetylation	IDA	biological process
GO:0140066	peptidyl-lysine crotonylation	IDA	biological process
GO:0061921	peptidyl-lysine propionylation	IDA	biological process
GO:0140065	peptide butyryltransferase activity	IDA	molecular function
GO:0140067	peptidyl-lysine butyrylation	IDA	biological process
GO:0140067	peptidyl-lysine butyrylation	IDA	biological process
GO:0140065	peptide butyryltransferase activity	IDA	molecular function
GO:0045721	negative regulation of gluconeogenesis	IDA	biological process
GO:0035257	nuclear hormone receptor binding	IPI	molecular function
GO:0031648	protein destabilization	IMP	biological process
GO:0050821	protein stabilization	ISS	biological process
GO:0010821	regulation of mitochondrion organization	ISS	biological process
GO:0045444	fat cell differentiation	ISS	biological process
GO:0007623	circadian rhythm	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006990	positive regulation of transcription from RNA polymerase II promoter involved in unfolded protein response	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008134	transcription factor binding	IPI	molecular function
GO:0030511	positive regulation of transforming growth factor beta receptor signaling pathway	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003713	transcription coactivator activity	IMP	molecular function
GO:0004402	histone acetyltransferase activity	IEA	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0042025	host cell nucleus	IEA	cellular component
GO:0000123	histone acetyltransferase complex	IEA	cellular component
GO:0003712	transcription coregulator activity	IEA	molecular function
GO:0003713	transcription coactivator activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0016573	histone acetylation	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0048511	rhythmic process	IEA	biological process
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016032	viral process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0007399	nervous system development	TAS	biological process
GO:0004402	histone acetyltransferase activity	IEA	molecular function
GO:0008022	protein C-terminus binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016407	acetyltransferase activity	EXP	molecular function
GO:0016407	acetyltransferase activity	EXP	molecular function
GO:0016407	acetyltransferase activity	EXP	molecular function
GO:0006283	transcription-coupled nucleotide-excision repair	TAS	biological process
GO:0016579	protein deubiquitination	TAS	biological process
GO:0032481	positive regulation of type I interferon production	TAS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	TAS	biological process
GO:0061733	peptide-lysine-N-acetyltransferase activity	TAS	molecular function
GO:0061733	peptide-lysine-N-acetyltransferase activity	TAS	molecular function
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:1904837	beta-catenin-TCF complex assembly	TAS	biological process
GO:0002223	stimulatory C-type lectin receptor signaling pathway	TAS	biological process
GO:0004402	histone acetyltransferase activity	TAS	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	TAS	biological process
GO:0007219	Notch signaling pathway	TAS	biological process
GO:0007221	positive regulation of transcription of Notch receptor target	TAS	biological process
GO:0045652	regulation of megakaryocyte differentiation	TAS	biological process
GO:0045747	positive regulation of Notch signaling pathway	TAS	biological process
GO:0045815	positive regulation of gene expression, epigenetic	TAS	biological process
GO:0051726	regulation of cell cycle	TAS	biological process
GO:0061418	regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS	biological process
GO:1900034	regulation of cellular response to heat	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0097157	pre-mRNA intronic binding	IEA	molecular function
GO:0060325	face morphogenesis	IEA	biological process
GO:0050821	protein stabilization	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0045444	fat cell differentiation	IEA	biological process
GO:0036268	swimming	IEA	biological process
GO:0032991	protein-containing complex	IEA	cellular component
GO:0032092	positive regulation of protein binding	IEA	biological process
GO:0030220	platelet formation	IEA	biological process
GO:0030183	B cell differentiation	IEA	biological process
GO:0016407	acetyltransferase activity	IEA	molecular function
GO:0010821	regulation of mitochondrion organization	IEA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0009887	animal organ morphogenesis	IEA	biological process
GO:0007611	learning or memory	IEA	biological process
GO:0006473	protein acetylation	IEA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0004402	histone acetyltransferase activity	IEA	molecular function
GO:0003682	chromatin binding	IEA	molecular function
GO:0002039	p53 binding	IEA	molecular function
GO:0001085	RNA polymerase II transcription factor binding	IEA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0140069	histone butyryltransferase activity	IEA	molecular function
GO:0140067	peptidyl-lysine butyrylation	IEA	biological process
GO:0061733	peptide-lysine-N-acetyltransferase activity	IEA	molecular function
GO:0051091	positive regulation of DNA-binding transcription factor activity	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0035855	megakaryocyte development	IEA	biological process
GO:0035264	multicellular organism growth	IEA	biological process
GO:0031490	chromatin DNA binding	IEA	molecular function
GO:0030324	lung development	IEA	biological process
GO:0016573	histone acetylation	IEA	biological process
GO:0008134	transcription factor binding	IEA	molecular function
GO:0007623	circadian rhythm	IEA	biological process
GO:0007519	skeletal muscle tissue development	IEA	biological process
GO:0007507	heart development	IEA	biological process
GO:0006990	positive regulation of transcription from RNA polymerase II promoter involved in unfolded protein response	IEA	biological process
GO:0005667	transcription regulator complex	IEA	cellular component
GO:0003713	transcription coactivator activity	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0002209	behavioral defense response	IEA	biological process
GO:0001966	thigmotaxis	IEA	biological process
GO:0001756	somitogenesis	IEA	biological process
GO:0001102	RNA polymerase II activating transcription factor binding	IEA	molecular function
GO:0000123	histone acetyltransferase complex	IEA	cellular component
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0008013	beta-catenin binding	IPI	molecular function
GO:0050681	androgen receptor binding	IPI	molecular function
GO:0001102	RNA polymerase II activating transcription factor binding	IPI	molecular function
GO:0043923	positive regulation by host of viral transcription	IDA	biological process
GO:0060765	regulation of androgen receptor signaling pathway	IDA	biological process
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0001666	response to hypoxia	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0003677	DNA binding	IDA	molecular function
GO:0004402	histone acetyltransferase activity	IDA	molecular function
GO:0051091	positive regulation of DNA-binding transcription factor activity	IDA	biological process
GO:0018076	N-terminal peptidyl-lysine acetylation	IDA	biological process
GO:0006355	regulation of transcription, DNA-templated	IDA	biological process
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0003682	chromatin binding	IMP	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0033613	activating transcription factor binding	IPI	molecular function
GO:0006915	apoptotic process	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016407	acetyltransferase activity	IMP	molecular function
GO:0043967	histone H4 acetylation	IMP	biological process
GO:0008134	transcription factor binding	IPI	molecular function
GO:0008134	transcription factor binding	IPI	molecular function
GO:0008134	transcription factor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0097677	STAT family protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05016	Huntington disease
hsa05165	Human papillomavirus infection
hsa05206	MicroRNAs in cancer
hsa04024	cAMP signaling pathway
hsa05166	Human T-cell leukemia virus 1 infection
hsa05203	Viral carcinogenesis
hsa04310	Wnt signaling pathway
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa05152	Tuberculosis
hsa04630	JAK-STAT signaling pathway
hsa05164	Influenza A
hsa05161	Hepatitis B
hsa04110	Cell cycle
hsa04068	FoxO signaling pathway
hsa04935	Growth hormone synthesis, secretion and action
hsa04919	Thyroid hormone signaling pathway
hsa04922	Glucagon signaling pathway
hsa04916	Melanogenesis
hsa04066	HIF-1 signaling pathway
hsa04350	TGF-beta signaling pathway
hsa05215	Prostate cancer
hsa04720	Long-term potentiation
hsa04520	Adherens junction
hsa04330	Notch signaling pathway
hsa05211	Renal cell carcinoma

Diseases

Associated diseases	References
Follicular lymphoma	KEGG:H01613
Rubinstein-Taybi syndrome	KEGG:H00504
Follicular lymphoma	KEGG:H01613
Rubinstein-Taybi syndrome	KEGG:H00504
Cardiomyopathy	PMID:20375365
Prostate cancer	PMID:14633682
Alzheimer's disease	PMID:23585551
Rubinstein-Taybi syndrome	PMID:17220215
Breast carcinoma	PMID:12725419
clear cell renal cell carcinoma	PMID:23029358
clear cell renal cell carcinoma	PMID:28551630
congestive heart failure	PMID:12724418
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)