• Gene id: 203259

Gene Summary

• Gene Symbol: FAM219A   Gene   UCSC   Ensembl
• Aliases: C9orf25
• Gene name: family with sequence similarity 219 member A
• Alternate names: protein FAM219A, uncharacterized protein C9orf25,
• Gene location: 9p13.3 (202265762: 202303660)     Exons: 15     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene has homologs that have been identified in mouse, macaque, etc organisms. Multiple alternatively spliced transcript variants that encode different protein isoforms have been described for this gene. [provided by RefSeq, Dec

Protein Summary

• Protein general information: Q8IW50  
  • Name: Protein FAM219A
  • Length: 185  
  • Mass: 20400
• Sequence:

  MMEEIDRFQVPTAHSEMQPLDPAAASISDGDCDAREGESVAMNYKPSPLQVKLEKQRELARKGSLKNGSMGSPVN
  QQPKKNNVMARTRLVVPNKGYSSLDQSPDEKPLVALDTDSDDDFDMSRYSSSGYSSAEQINQDLNIQLLKDGYRL
  DEIPDDEDLDLIPPKSVNPTCMCCQATSSTACHIQ

• Structural information:
  • Interpro: IPR029339  
  • STRING: ENSP00000392452
• Other Databases: GeneCards:  FAM219A  Malacards:  FAM219A

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq