• Gene id: 203245

Gene Summary

• Gene Symbol: NAIF1   Gene   UCSC   Ensembl
• Aliases: C9orf90, bA379C10.2
• Gene name: nuclear apoptosis inducing factor 1
• Alternate names: nuclear apoptosis-inducing factor 1,
• Gene location: 9q34.11 (128067866: 128061232)     Exons: 3     NC_000009.12
• OMIM: 610673

Protein Summary

• Protein general information: Q69YI7  
  • Name: Nuclear apoptosis inducing factor 1
  • Length: 327  
  • Mass: 35164
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MAVPAKKRKMNFSEREVEIIVEELELKKHLLVNHFNAGVPLAAKSAAWHGILRRVNAVATCRRELPEVKKKWSDL
  KTEVRRKVAQVRAAVEGGEAPGPTEEDGAGGPGTGGGSGGGGPAVAPVLLTPMQQRICNLLGEATIISLPSTTEI
  HPVALGPSATAAAATVTLTQIPTETTYHTLEEGVVEYCTAEAPPPLPPETPVDMMAQHADTSVKPQALKSRIALN
  SAKLIQEQRVTNLHVKEIAQHLEQQNDLLQMIRRSQEVQACAQERQAQAMEGTQAALSVLIQVLRPMIKDFRRYL
  QSNTANPAPASDPGQVAQNGQPDSIIQ

• Structural information:
  • Interpro: IPR028002  IPR026753  
  • STRING: ENSP00000362170
• Other Databases: GeneCards:  NAIF1  Malacards:  NAIF1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:1902108	regulation of mitochondrial membrane permeability involved in apoptotic process	IDA	biological process
GO:0030308	negative regulation of cell growth	IDA	biological process
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray