• Gene id: 203190

Gene Summary

• Gene Symbol: LGI3   Gene   UCSC   Ensembl
• Aliases: LGIL4
• Gene name: leucine rich repeat LGI family member 3
• Alternate names: leucine-rich repeat LGI family member 3, LGI1-like protein 4, leucine-rich glioma-inactivated protein 3,
• Gene location: 8p21.3 (22156805: 22146829)     Exons: 8     NC_000008.11

Protein Summary

• Protein general information: Q8N145  
  • Name: Leucine rich repeat LGI family member 3 (LGI1 like protein 4) (Leucine rich glioma inactivated protein 3)
  • Length: 548  
  • Mass: 61704
  • Tissue specificity: Widely expressed, with highest levels in brain and lung. {ECO
• Sequence:

  MAGLRARGGPGPGLLALSALGFCLMLQVSAKRPPKTPPCPPSCSCTRDTAFCVDSKAVPRNLPSEVISLTLVNAA
  FSEIQDGAFSHLPLLQFLLLNSNKFTLIGDNAFTGLSHLQYLFIENNDIWALSKFTFRGLKSLTHLSLANNNLQT
  LPRDIFRPLDILNDLDLRGNSLNCDCKVKWLVEWLAHTNTTVAPIYCASPPRFQEHKVQDLPLREFDCITTDFVL
  YQTLAFPAVSAEPFLYSSDLYLALAQPGVSACTILKWDYVERQLRDYDRIPAPSAVHCKPMVVDSQLYVVVAQLF
  GGSYIYHWDPNTTRFTRLQDIDPQRVRKPNDLEAFRIDGDWYFAVADSSKAGATSLYRWHQNGFYSHQALHPWHR
  DTDLEFVDGEGKPRLIVSSSSQAPVIYQWSRTQKQFVAQGEVTQVPDAQAVKHFRAGRDSYLCLSRYIGDSKILR
  WEGTRFSEVQALPSRGSLALQPFLVGGRRYLALGSDFSFTQIYQWDEGRQKFVRFQELAVQAPRAFCYMPAGDAQ
  LLLAPSFKGQTLVYRHIVVDLSA

• Structural information:
  • Protein Domains: (31..6-)
    (/note="LRRNT-)
    (170..22-)
    (/note="LRRCT"-)
  • Interpro: IPR000483  IPR009039  IPR005492  IPR001611  IPR003591   IPR032675  IPR011041  
  • Prosite: PS50912 PS51450
  • STRING: ENSP00000302297
• Other Databases: GeneCards:  LGI3  Malacards:  LGI3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003824	catalytic activity	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0006887	exocytosis	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0008021	synaptic vesicle	IEA	cellular component
GO:0017157	regulation of exocytosis	IEA	biological process
GO:0008021	synaptic vesicle	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0003824	catalytic activity	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0006887	exocytosis	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0008021	synaptic vesicle	IEA	cellular component
GO:0017157	regulation of exocytosis	IEA	biological process
GO:0008021	synaptic vesicle	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq