• Gene id: 203100

Gene Summary

• Gene Symbol: HTRA4   Gene   UCSC   Ensembl
• Gene name: HtrA serine peptidase 4
• Alternate names: serine protease HTRA4, high-temperature requirement factor A4, probable serine protease HTRA4,
• Gene location: 8p11.22 (38974148: 38988662)     Exons: 3     NC_000008.11
• Gene summary(Entrez): This gene encodes a member of the HtrA family of proteases. The encoded protein contains a putative signal peptide, an insulin growth factor binding domain, a Kazal protease inhibitor domain, a conserved trypsin domain and a PDZ domain. Based on studies o
• OMIM: 610700

Protein Summary

• Protein general information: P83105  
  • Name: Serine protease HTRA4 (EC 3.4.21. ) (High temperature requirement factor A4)
  • Length: 476  
  • Mass: 50979
• Sequence:

  MIRPQLRTAGLGRCLLPGLLLLLVPVLWAGAEKLHTQPSCPAVCQPTRCPALPTCALGTTPVFDLCRCCRVCPAA
  EREVCGGAQGQPCAPGLQCLQPLRPGFPSTCGCPTLGGAVCGSDRRTYPSMCALRAENRAARRLGKVPAVPVQWG
  NCGDTGTRSAGPLRRNYNFIAAVVEKVAPSVVHVQLWGRLLHGSRLVPVYSGSGFIVSEDGLIITNAHVVRNQQW
  IEVVLQNGARYEAVVKDIDLKLDLAVIKIESNAELPVLMLGRSSDLRAGEFVVALGSPFSLQNTATAGIVSTKQR
  GGKELGMKDSDMDYVQIDATINYGNSGGPLVNLDGDVIGVNSLRVTDGISFAIPSDRVRQFLAEYHEHQMKGKAF
  SNKKYLGLQMLSLTVPLSEELKMHYPDFPDVSSGVYVCKVVEGTAAQSSGLRDHDVIVNINGKPITTTTDVVKAL
  DSDSLSMAVLRGKDNLLLTVIPETIN

• Structural information:
  • Protein Domains: (36..9-)
    (/note="IGFBP-N-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00653-)
    (88..15-)
    (/note="Kazal-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00798-)
    (383..47-)
    (/note="PDZ-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU-)
  • Interpro: IPR009030  IPR000867  IPR002350  IPR036058  IPR001478   IPR036034  IPR009003  IPR001940  
  • Prosite: PS51323 PS51465 PS50106
  • STRING: ENSP00000305919
• Other Databases: GeneCards:  HTRA4  Malacards:  HTRA4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway	ISS	biological process
GO:0004252	serine-type endopeptidase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0005520	insulin-like growth factor binding	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004175	endopeptidase activity	IDA	molecular function
GO:0006508	proteolysis	IDA	biological process
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)